KEGG   Scleropages formosus (Asian bonytongue): 108918987Help
Entry
108918987         CDS       T04919                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
Enzymes [BR:sfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108918987
Cell adhesion molecules and their ligands [BR:sfm04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     108918987
   VLA-5
     108918987
   VLA-9
     108918987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 681 aa AA seqDB search
MRSLPVPAVFSKVDLQCWANNPAHHTEEMNNERLLVRRGQPFFVALQCTGSTPQPPERCI
NLILHLGKEVVKVSDMRANQSQWWFHKQEAQSELFLTVYSPADAPVGLYSMTVVLLNAEG
HIQERIHAGSFYLLFNPWCKADSVYFPDEGQLQEYILNENGLLYQGSWDQIRPLPWNFGQ
FEKDVVDICFEILDNSPAALKNPEVDTANRADPVYVSRTVTAMVNSNDDRGVVSGRWDGE
YSDGVPPTRWTGSVPILRSWSSGGAQRVRYGQCWVFSGVACTVLRCLGIPTRCVTNFSSA
HDTDGNLTVDYCYNEQLENVSAGKKDMIWNFHCWVESWMSRDDLLEGYDGWQVLDPTPQE
RSDGVFCCGPCPVKAIKEGEVEVKYDTAFVFSEVNADLACWIIHEDGQRTQASLHHGTVG
RNISTKSVYGEQREDITSLYKYPEGSNMEREMYEKAGRRVSERNGGSGQLELSIKHVQAV
HGTDFDVVVEVQNKGSQDTPAKLTITSNAVTYNSLHLGECQRQSASLTVPAQKVHKEVLR
LLYDHYGACLSEHRLIRVTALLQTSSDHDSILQEVNIPLAVPELDVKVVGVPVVSHKLTT
YITFTNPLPITLRGGLFTVEGPGLTAAKEIPAPEDIGPGQIVSVKFSFKPARAGLRKLLV
DFDADRLKDVKGSATVIVRKK
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgcggtctctcccagttccagctgtcttcagcaaggtggacctgcagtgttgggccaac
aatccagctcaccacacagaggagatgaacaacgagcgtctgcttgtccgcagggggcaa
cccttcttcgttgccctgcagtgcacgggttcaacaccgcaacctcccgaacggtgcatc
aacctcatcttgcaccttggtaaggaggtggtgaaggtatcagacatgcgtgccaaccaa
agccagtggtggttccacaagcaggaggcacagagcgagctcttcctaacagtgtacagt
cccgccgatgcccccgtgggcctctacagcatgacggtggtgctgctgaatgcggaagga
cacatccaggagcgcatccatgctgggagtttctacctactattcaatccctggtgcaaa
gctgactcggtgtacttccccgacgaggggcagctgcaggaatacatcctaaatgaaaat
ggcctgctgtaccagggctcctgggaccagatccgtcccttgccgtggaacttcggacag
ttcgagaaggacgtggtggacatctgcttcgaaatcctggacaactctccggcggcactc
aaaaaccccgaggtggacacggctaaccgggccgacccggtttacgtgagcagaacggta
acggcgatggtaaactccaatgacgaccggggcgtggtttcaggtcgctgggatggggag
tactcggacggagtgccccccacacgatggacaggcagcgtacccatcctgcggagctgg
agcagcggtggagcacagagggtgcgctatggccagtgttgggtgttctcaggtgtggct
tgtacagtcctgcgctgcctgggcatccccactcgctgcgttaccaacttctcctccgcc
catgacacagatggcaacctcactgtggactactgctacaatgagcagctggagaatgtg
tctgctggcaagaaggatatgatttggaacttccattgctgggtggagtcatggatgagc
cgagatgaccttctagagggttatgatgggtggcaggtgttggaccccacaccccaggag
aggagtgatggtgtgttctgttgtgggccctgtcctgtgaaagcaatcaaggaaggtgag
gtggaggtgaagtacgacacagcatttgtgttttcggaggtaaacgcagacctggcctgc
tggatcatccacgaggatgggcaacgcacccaagcgtctcttcatcatggcactgtgggc
cgcaacatcagcaccaagagtgtgtatggagagcagagggaggatattacctccctctac
aagtacccggaaggttcaaacatggagcgggagatgtatgagaaggcagggcggagggtg
tctgaacggaacggaggatcgggacagctggagctatccatcaagcatgtccaggcagtg
cacggcacagacttcgacgtcgttgtggaggtccagaacaagggttcacaggacacgcct
gccaaactgaccatcacctccaatgctgtcacctacaacagtctccatcttggggaatgc
cagaggcagagtgccagcctcaccgtgccagcacagaaggtgcataaggaggttttgcgg
ctgctgtacgaccactatggggcctgcttgtctgagcaccgcctgatcagggtcaccgcg
ctactgcagaccagcagtgaccatgatagtatcctgcaggaggtcaacattccactggcc
gtacccgagctcgacgtcaaggtggtaggggtgccggttgtttctcacaagctgaccaca
tacatcaccttcaccaatccactgcccatcaccctcaggggtggcttgttcactgtggag
ggtccaggactcacagctgcaaaggaaatccctgcaccagaggatattggaccaggtcag
attgtgtccgtcaagttttccttcaagcccgctcgggccggactccggaagctgttggtg
gacttcgatgcggacaggctgaaggatgtcaagggctctgccacagtgatcgtgaggaaa
aagtga

DBGET integrated database retrieval system