KEGG   Scleropages formosus (Asian bonytongue): 108920376Help
Entry
108920376         CDS       T04919                                 

Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00250  Alanine, aspartate and glutamate metabolism
sfm00410  beta-Alanine metabolism
sfm00430  Taurine and hypotaurine metabolism
sfm00650  Butanoate metabolism
sfm01100  Metabolic pathways
Module
sfm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    108920376
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108920376
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108920376
   00430 Taurine and hypotaurine metabolism
    108920376
Enzymes [BR:sfm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108920376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 108920376
NCBI-ProteinID: XP_018584615
UniProt: A0A1W4Y8N6
LinkDB All DBs
Position
Unknown
AA seq 590 aa AA seqDB search
MAASAPSSSAAEPEPNSAYLRPPTSAYDSWCGVAHGCTRKLGMKICGFLQKNNSLDEKSR
IGGSFKERQSSKNVLSCENRDPRFGHTETDFSNLFARDLLPAKNGEEPTMQFLLEVVDIL
TNYIRKTFDRSTKVLDFHHPHQLLEGIEGFNLELSDQPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGWPGGEG
DGIFSPGGAISNMYSVMVARYKYYPEVKTKGMSAAPRLILFTSEHSHYSIKKAGAALGFG
VENVILLKCDERGRVIPADLEAKIIDAKQKGYVPLFVNATAGSTVYGAFDPINEIADLCE
KYNMWLHVDGAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKGLL
QGCNQMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTSGFEQHINKCL
ELSEYLYTKIKNREGYEMVFQGEPQHTNVCFWYLPPSLRGMPDCPERRERLHKVAPKIKA
MMMESGTTMVGYQPQGDKVNFFRMVVSNPAATKSDIDFLIEEIERLGQDL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtccgctccctcttcttcggccgcggagccggagcccaactccgcttatcta
cgaccccccacctcagcctatgactcatggtgcggagttgctcatggatgtacaaggaaa
ctgggaatgaagatctgtgggttccttcagaagaacaacagcctggatgagaagagcagg
attggtggttccttcaaggaacgtcaatcttccaagaatgttctgtcctgtgaaaacaga
gacccgcgtttcggacacacggagaccgacttctcaaatctttttgccagggatctatta
ccagccaaaaatggagaggagcccaccatgcagttcttgctggaggttgttgacattctt
acaaactatattcggaagacctttgatagatccacaaaagtcctggactttcaccacccc
catcagctgcttgaaggcattgaggggttcaacctggagctctcagaccagcccgagtct
ttggagcagattctggtcgactgcagggacacactcaagtacggagtaaggacaggtcac
cccaggttcttcaaccagctgtcatctggcctggacataatcggcttggctggagaatgg
ctcacctccacagcaaacaccaacatgttcacctatgagattgcaccggtttttgtgctt
atggaacagctgaccctgaagaaaatgagagagatagttgggtggccagggggagaagga
gatgggatattttcaccaggtggagcaatatccaacatgtacagtgtgatggtggcgcgg
tacaagtattaccctgaggtcaagaccaaaggcatgtctgccgcccccaggctgattctc
ttcacatcagagcatagccactactcgataaagaaagccggcgctgctctgggctttgga
gtagaaaatgtgattctactgaagtgtgatgagagaggaagagtaattcctgcagactta
gaggccaagatcatagatgccaaacagaagggctacgtccccctgtttgtgaacgccaca
gccggctccactgtgtacggtgccttcgaccccatcaacgagatcgccgacctctgcgag
aagtacaacatgtggctgcatgtggatggcgcctggggcggaggcctgctgatgtccagg
aaacaccggcacaagctgagtggcatagagagggccaattcggtcacctggaacccacac
aagatgatgggtgttccactgcagtgctccgcaatcctggtcagggagaaggggctgctg
caggggtgcaaccagatgtgtgcaggctacctcttccaaccagacaagcaatacgacgtc
acctatgacaccggggacaaggccatccagtgtggccgccatgtcgacatcttcaagttt
tggctcatgtggaaggcaaaggggacgtcagggtttgaacaacatatcaacaagtgcttg
gagctctccgaatacctctataccaaaataaagaaccgcgaagggtacgagatggtgttc
cagggagagccccaacacaccaacgtctgtttctggtaccttccccccagcttgaggggt
atgccggactgccccgaacgccgtgagaggctgcacaaggtggcacccaaaatcaaagcc
atgatgatggagtccggaaccaccatggttggctaccagcctcagggagacaaagtcaat
ttcttccggatggtcgtatccaaccctgctgccacaaagtcggacatcgacttcctcatc
gaggaaatcgagcggctagggcaggacttgtag

DBGET integrated database retrieval system