KEGG   Scleropages formosus (Asian bonytongue): 108927129Help
Entry
108927129         CDS       T04919                                 

Gene name
gsto1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00480  Glutathione metabolism
sfm00980  Metabolism of xenobiotics by cytochrome P450
sfm00982  Drug metabolism - cytochrome P450
sfm00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:sfm00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    108927129 (gsto1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108927129 (gsto1)
   00982 Drug metabolism - cytochrome P450
    108927129 (gsto1)
   00983 Drug metabolism - other enzymes
    108927129 (gsto1)
Enzymes [BR:sfm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108927129 (gsto1)
Transporters [BR:sfm02000]
 Other Transporters
  Pores ion channels [TC:1]
   108927129 (gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C Glutaredoxin AHSP
Motif
Other DBs
NCBI-GeneID: 108927129
NCBI-ProteinID: XP_018595733
UniProt: A0A0P7UB17
LinkDB All DBs
Position
Unknown
AA seq 239 aa AA seqDB search
MASERSVAEGSSAPGPVPKGKIRIYSMRFCPFAQRARLVLAAKGIRYDIININLKNKPSW
FLEKNPLGAVPVLETDHGEIIYESPIVCEYLDEMYKQKKLFPEDPFEKAKQKMLLEEFSK
VIPYFYKVLTGRSKCENTSAAEQELKEKLAKLNETLLQKKTRFFGGNSVTMIDYLMWPWF
ERVDGYGVRHCLDGASQLQQWMQDMMDDPVIKATMFDSETHKAFLQSFCDGKPNYDLGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagagaggagtgtcgccgaagggtcctcggccccgggccccgtccccaagggc
aaaatccgcatctacagcatgaggttttgcccgtttgctcagagggctcggctggtcctc
gccgccaaaggcatcaggtatgacatcattaacatcaatctgaagaacaaacccagctgg
tttttggagaagaacccgttgggggcggttcccgtgctggagactgaccacggcgagatc
atctatgagtcgcccatcgtgtgcgagtacctggacgaaatgtacaagcagaagaagctc
ttcccagaggacccgtttgagaaggcgaagcagaagatgcttctggaggagttctccaag
gtcataccgtacttctacaaggtactcacaggaaggagcaaatgtgagaacacgtcggcc
gcggagcaggagctcaaggagaagctggctaaactgaatgagactctccttcagaagaag
accaggttcttcgggggaaactcggtcactatgatcgactacctcatgtggccgtggttc
gagagggtggatggctacggcgtgaggcactgcttggatggtgcctctcagctgcaacag
tggatgcaggacatgatggatgaccctgtcatcaaagccaccatgtttgacagcgagacc
cacaaggccttcctgcagagcttctgtgacggcaaaccaaactacgacctgggcctctag

DBGET integrated database retrieval system