KEGG   Scleropages formosus (Asian bonytongue): 108928574Help
Entry
108928574         CDS       T04919                                 

Gene name
pcsk1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     108928574 (pcsk1)
Peptidases [BR:sfm01002]
 Serine Peptidases
  Family S8: subtilisin family
   108928574 (pcsk1)
Chaperones and folding catalysts [BR:sfm03110]
 Intramolecular chaperones
  Subtilisin family
   108928574 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 760 aa AA seqDB search
MDVRCRLPILFLALALFSAASDSPGSGVDVQYVNEWAVEIPGGLDTARAIAEELGYELVR
QIGALENHYLFKHNTHPKRTKRSADHMTKRLSEDQRVSWAEQQYEKQRRKRAPLEAHCPD
CAVDKLFDDPMWSQQWYLQDTRTSSSLPKLDLHVIPVWRKGITGKGVVITVLDDGLEWNH
TDIFPNYDQAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNSK
VGGIRMLDGIVTDAIEASSIGFNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQK
GRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATA
YSSGDYTDQRITSADLHNECTETHTGTSASAPLAAGIFALALEENPDLTWRDLQHLVVWT
SEFDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCIVMDDTF
QPRALKAAGEITIEIPTKACSGQDNVIKSLEHIQVEASIEYTRRGDLHITLTSPSGTSTV
LLAERERDTSSSGFKNWDFMSVHTWGEDPAGTWVLKITDTSGRLENKGQIISWKLILHGT
SQRPEHMKSPRVYVPYNAVQNDRRGLERMEDMMKEGPTEAQQSLKTPKSTHGEAKKERVP
SAALMRLLQTAFNRQSVGSQPHTAQPEPTAVPRDQKEESASLHIPYQNLYQALDLLNKYR
GSEENLYSDYSDVFYNAKPYKHRDDRLLQALFDMITEDSH
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgagatgtcggctgcccattcttttcctcgctcttgcgcttttctctgccgcc
tccgactctccgggatctggcgtggacgtgcagtatgtgaacgaatgggcggtggagata
cccggaggactcgacactgcccgggcgatagccgaggagctcggctacgaactggtccga
cagattggtgcattagaaaaccactacttattcaaacacaacactcatcccaagaggaca
aagcggagcgcagaccatatgaccaagaggctgtcggaggaccaaagggtgtcctgggca
gaacagcaatatgagaagcagcgcaggaagcgggcgccactggaggcacactgtcccgat
tgtgctgtggacaagctcttcgatgaccccatgtggagccagcagtggtacctgcaagac
accaggacatcttcctccttgcccaaactggacctccatgtgattccagtctggcggaaa
ggaatcactgggaagggggtggtcattactgtgctggatgatggactggagtggaatcac
acagatatcttccccaattatgatcaagctgccagttacgactttaatgataacgaccct
gacccctttcccagatatgactccactaacgagaacaagcacgggacaaggtgtgctgga
gaaattgcaatgcaggcagacaacaataagtgtggagttggagtggcatacaattctaaa
gttggaggaattcgaatgctggatggaatagtgacagatgccattgaggcgagctccatc
ggttttaatccggaccatgtggacatctacagtgccagctgggggccaaatgatgatggc
aaaactgtggaggggcctggtcgccttgcacagaaagcctttgagtatggaatccaaaag
ggtcgtggtggcaaggggtcaatctttgtgtgggcctctggcaacggaggcagacagggg
gacaactgtgactgtgatggctacacagatagcatctacaccatctccatcagcagtgcg
tcccagcagggcctatccccttggtatgctgaaaaatgctcgtccacccttgccacagca
tatagcagtggggactacacagaccagagaattaccagcgcagacttgcacaatgaatgc
acagagacacacactggaacctcagcttctgccccacttgcagccgggatctttgctttg
gccttggaggagaacccagacctcacgtggcgggacctgcagcatctggttgtgtggacg
tcagagttcgaccctctggcaaacaatccaggctggaagaagaatggtgccggacttatg
gtcaacagcaggtttggctttggcctcctgaatgccaaggcactggtggacctggcagac
cccaaagtgtggaagcatgttccagaaaaaaagcagtgcattgtgatggatgatactttc
cagccaagggcactgaaagctgcaggagagattactattgaaatccctactaaggcctgc
agtgggcaggataatgtcatcaagtctctagagcacatacaggtggaggctagtattgag
tacaccaggagaggggacctgcacatcaccctaacctctccctcaggaacaagcacagtt
ctcttagctgagcgagagcgggacacctcctccagtggcttcaaaaactgggactttatg
tccgttcatacctggggtgaggaccctgctggcacctgggtactgaagattacagacacg
tctggacgcttagagaataaaggccagattattagttggaagctgattctgcatggcaca
tcacagcgccctgagcatatgaaatcaccgagagtctatgtcccatacaacgccgttcag
aacgaccgcaggggactggaaaggatggaggacatgatgaaggaaggtccaactgaggct
cagcagtctcttaagactccaaagtcaacacatggagaggccaagaaagagagggtccca
tctgctgctctcatgcggctcctccagaccgctttcaatagacaatcagtaggcagccag
ccccacactgctcagccagagcccactgccgtgcctagagaccagaaggaggaaagtgca
agtttgcacatcccctatcagaacctctaccaagccctggacctgctgaataaatacaga
ggctcagaagagaacctgtacagcgactacagcgatgtgttctacaatgccaagccatac
aaacacagggatgacagactcctgcaagccctctttgacatgatcactgaagacagccac
tga

DBGET integrated database retrieval system