KEGG   Scleropages formosus (Asian bonytongue): 108932000Help
Entry
108932000         CDS       T04919                                 

Gene name
f13a1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
Enzymes [BR:sfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108932000 (f13a1)
Cell adhesion molecules and their ligands [BR:sfm04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     108932000 (f13a1)
   VLA-9
     108932000 (f13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 730 aa AA seqDB search
MSAPEGHPQRSTISHRGRSSVPVANSNTDGKDVPEFEPFGLMPRGPPPLKEFLDIWDVNM
LNQPNEINKRNHHTHLYATENLIVRRGQEFQIRITFDRPYKPTQDHFLVEFVIGSYPQVS
KGTYIPLRVDEELSGSWRGRVVQTMDNMVTVGITPAPDCIVGRFRMYVAVITPYGIRRTQ
KDPSRDVYILFNPWSPADTVFLNDEAERDECILNESGIIFYGEASDISVRPWNYGQFEYG
VLDACLQVMDRATMPLVNRGDAVKVARMASAMMNSKDDDGVLVGNWTGDYFYGVAPTSWT
GSVEILLDYANSNQGVCYAQCWVYAGVFNTFLRCLGIPARVVSNFYSAHDNDGNLRTDII
LDENGKVDKERTKDSIWNYHCWNECYMARTDLPQGFGGWQVVDATPQETSDGLYRCGPAS
VHAIKHGQVCYPFDAPFIFAEVNSDVVFYQRNKNGTLEPVRVNKSHVGRMVLTKDIGKES
ARDITSQYKFAEDTEEERTVLQKAEEFGCSRIQSTLPPADVEMKASVQDVMVGNDFQLSL
EFRNQSDSHRTTNVYISGNVVYYTGVTSSEFILKTQNVTLKPFESKVVIVDVKSQEYLRK
LVDQANLHFIITGRVDESGQIITAMHVVSLHTPKLSIKVSGTARVSEEMLVTVEFTNPFK
FNLEDVSVRMEGPGLMLAKKKQYSLIPTNSTLTWTESFKPRRSGQAWLMASLDCQALRQV
YGHLEVNIQP
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcccccgaaggccacccccagcgaagcaccatctcccaccgcggccgcagctcc
gtgcccgtggccaactccaacaccgatggcaaagatgtcccggagtttgagcccttcggc
ttgatgcctcgcggccccccgccgctcaaggaattcctggacatctgggatgtgaacatg
ctcaaccagccaaatgagatcaacaagaggaaccaccacacacatctgtacgccactgag
aacctcatcgtgcgccggggtcaggagttccagatcaggatcacctttgaccgtccctac
aagcccacccaggaccacttccttgtggagtttgtaattggcagctacccacaggtcagc
aaagggacctacatcccacttcgcgtcgatgaggagctatcggggtcatggagagggcgg
gtggtgcagacgatggacaacatggtcacagtgggcatcactccggctcctgactgcatc
gtgggaagatttcgcatgtatgtggcggtcatcacgccctacggcattcgcaggacccag
aaggaccccagccgagatgtttacatcttattcaacccctggtcaccagctgacacagtg
ttcctgaatgacgaagcagagcgagacgagtgcatcctgaatgaatctgggatcattttc
tacggggaagccagtgacatttcagtccgaccttggaattatggccagtttgagtacgga
gttctggatgcctgtctccaagtgatggaccgggctaccatgccccttgtcaatagagga
gatgcagtcaaagtggcccgcatggcttcagctatgatgaactcaaaggatgacgatgga
gtcctggtggggaattggactggagattacttctacggggtggcacccacatcctggaca
ggcagcgtggaaatcctgctagattacgcgaacagcaaccaaggagtgtgctacgcgcag
tgttgggtctacgctggtgtcttcaacaccttcctgcggtgtctgggcatcccagctagg
gtggtctccaacttctactctgcccacgacaatgacggcaacttgagaactgacatcatc
ctggatgagaatgggaaggttgataaagagcgcacaaaggactccatctggaattaccac
tgctggaacgagtgctacatggccaggactgacctgccccagggctttggaggctggcag
gttgtggatgccacccctcaggagaccagtgatggtttatacaggtgtggtccagcttct
gttcatgccatcaaacatggacaggtctgctatccctttgatgcgccatttatttttgca
gaggtgaacagtgatgttgtgttctatcaacggaacaagaatggcaccctggaaccagtg
agggtaaacaagtcccacgtgggacgaatggtgctgaccaaggacatcggcaaagagtca
gcaagggacatcacaagccagtacaaattcgctgaggacactgaggaggagaggacggtg
ctgcagaaggcagaggagtttggctgcagccggatccagtccactctgccgccagccgac
gtggagatgaaggcaagcgtccaagatgtcatggtgggcaacgacttccagctcagcctg
gagttccggaaccagagcgactcccaccgcactactaatgtctacatcagtggcaatgtg
gtttactacactggagtcacgagctctgagtttattctcaagacccagaatgtgacactg
aaaccctttgaatccaaagtggtgattgtggatgtgaaatcccaggaatacctgaggaag
ctggtggatcaggccaatctccacttcattattacggggcgcgtggatgagagtggccaa
atcatcactgccatgcacgtggtctccttgcacacccccaagctctccatcaaggtcagt
ggaacagcaagggtcagcgaggagatgctagtcacagtggagttcaccaaccccttcaag
tttaatctggaagatgtatcagtgcgcatggagggcccaggactcatgttggccaaaaaa
aagcagtacagcctcatcccaaccaactccaccttgacgtggacagagtccttcaagcct
cggaggtctgggcaagcctggctcatggccagcctggactgccaggccctcaggcaggtt
tatgggcatctggaggtcaacatccagccttga

DBGET integrated database retrieval system