KEGG   Scleropages formosus (Asian bonytongue): 108932827Help
Entry
108932827         CDS       T04919                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108932827 (hk1)
   00051 Fructose and mannose metabolism
    108932827 (hk1)
   00052 Galactose metabolism
    108932827 (hk1)
   00500 Starch and sucrose metabolism
    108932827 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    108932827 (hk1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108932827 (hk1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108932827 (hk1)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108932827 (hk1)
Membrane trafficking [BR:sfm04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108932827 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 913 aa AA seqDB search
MIAAQLLAYYFTELKDDQIKKIDKYLYAMRFSDETLLDIMNRFKREMENGLGKDTNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKRQTVQMESQIYDTPEDIMH
GSGTRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCAQTKLDEGILLTWTKRFKASGV
EGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGMLFEGRITPELLTKGKFETKHVSAIEKTKEGLSKAKEILTRLG
VEPSHEDCVAVQHVCAVVSFRSANLIAATLGAILLRLKDNKGSPRLRTTVGVDGSLYKMH
PHYARRLHKTVRRLVPESDVRFLLSESGSGKGAAMVTAVAYRLGGGXXXXEFQLTKAQLL
EVKERMRAEIQRGLSKETHELASVKMLPTFVRRTPDGTENGDFLALDLGGTNFRVLLVKI
RSGKRRSVEMHNKIYAIPLEVMQGTGEELFDHIVHCISDFLDYMGMKNARLPLGFTFSFP
CKQTSLDAGILIKWTKGFKATDCEGEDVVGLLREGIKRREEFDLDVVAVVNDTVGTMMTC
AYEEPTCEIGLIAGTGSNACYMEEMRNIETIEGNEGRMCVNMEWGAFGDNGCLDDIRTKY
DEAVDELSFNAGKQKYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETK
FLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGTVSLRAAQLCGAGMAAVVEKI
RENRGLDRLEITVGVDGTLYKLHPHFSRIMHQTVKELAPKCDVNFLLSEDGSGKGAALIT
AVGCRLRQQEQQS
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcggcacagctcctagcgtactacttcactgagctgaaggatgaccagatcaag
aagatcgacaagtacctgtacgccatgcgcttctcggatgagacgcttctggacatcatg
aaccgcttcaagagggagatggagaatggacttgggaaggacacgaaccccacagccact
gtgaagatgcttcccacatttgtgaggtccattcctgacggttccgaaaagggagatttc
attgctctcgatctgggggggtccaacttccgtatcctgcgggtgaaggtgtcccacgaa
aagaggcaaacggtgcagatggagagccagatctacgacaccccagaagacatcatgcat
ggcagtggcacccggctctttgaccatgtggccgaatgcctgggggactttatggagaag
caaaaaatcaaggacaagaaactcccagtaggattcaccttctccttcccatgtgcacaa
actaagctggatgagggtattctactgacctggacaaaacgattcaaagcaagtggcgtg
gaaggtgcggacgtggtcaaacttctcaacaaggccatcaagaagcgaggggactatgac
gctgatatcatggcagtggtcaacgacacagttggaactatgatgacctgtggatttgat
gaccagcgctgcgaagttggcataatcataggtacaggtaccaacgcctgctacatggag
gagttgaggcacattgaccttgtggagggagatgagggccgcatgtgcatcaacaccgag
tggggggcctttggggatgatggaatgctggaggacattcgtaccgagtttgaccgagag
attgacaggggctccctcaaccctgggaagcagctatttgagaagatggtcagtgggatg
tacatgggtgaactggtacgtctcattttggtcaagatggctaaagaagggatgctgttc
gaaggtcggattacacccgagctgctcaccaaaggaaaatttgaaacaaaacatgtctct
gcaattgaaaagaccaaggagggcctgagcaaggctaaggagatcctgacgcgcctgggc
gtggagccgtcacacgaggactgcgtggcagtgcagcacgtgtgcgctgtggtgtccttc
cgcagtgccaacctcatcgctgccacgcttggggccatcctgctcaggctgaaggacaac
aagggctctccgcgtctgcgcaccaccgtgggagttgatggatccctctacaagatgcac
cctcactatgcccggcgtctgcacaagactgtacggcggctggtcccggagtcggacgta
cgcttcctgctgtcagagagcgggagcggcaagggcgcggccatggtgaccgcggtggcg
taccggctgggggggggggnnnnnnnnnncgaattccagctcaccaaggctcagctgctg
gaggtcaaggagcgcatgagagcggagattcagagaggcctgtcaaaggagacccacgag
ttggcttccgtcaagatgctgcccacttttgtacgccgcacacctgatgggacagaaaat
ggagatttcctggcattggacctgggagggactaatttcagggtgttgctggtgaagatc
cgcagtggcaagcgacgctctgtggagatgcataacaaaatttatgcaattccactggag
gttatgcagggtactggagaggagcttttcgaccacatcgtgcactgcatctctgacttc
ctggactacatgggaatgaagaatgcccgcctgcctttgggcttcaccttctccttcccc
tgcaaacagacgagtctggatgcgggtatccttataaaatggaccaaaggtttcaaggcc
actgactgcgagggtgaggatgttgtgggcctgcttcgggaaggaatcaaacgaagagag
gagtttgacctggacgtagttgctgtggtgaatgacacagtagggacaatgatgacctgc
gcatatgaggagcccacatgtgagattggcctgattgcaggaactggtagtaatgcttgc
tacatggaggagatgaggaacatcgagacgatagagggtaatgagggccgaatgtgcgtc
aatatggagtggggtgcctttggtgataacggctgcctggatgacatcagaaccaaatat
gatgaagccgtggatgaactgtccttcaatgctggaaaacaaaagtacgagaagatgtgc
agcggaatgtacttgggtgagatcgtgaggaacatcctgattgacctcaccaaacgtggc
ttcctattcaggggccagatctccgagaccctgaagacaaggggtatctttgaaaccaag
ttcctatcccagattgagagtgaccggctggcgctgctacaggtcaggtccatcctgcag
caccttggcctggacagtacatgtgatgacagtatcatagtgaaggaggtgtgtggcacc
gtatccctccgggccgcccagctctgtggcgctggcatggctgctgtcgtcgagaaaatc
cgcgagaaccgtgggctggaccggctggaaattaccgtcggggtggacggcacactctac
aagctccacccacacttctctaggatcatgcaccagacggtgaaggagctggcgcccaag
tgcgacgtcaacttcctcttgtctgaggatggcagcggcaagggggctgccctcatcaca
gccgtgggctgccgtctacgccaacaggagcaacagagctga

DBGET integrated database retrieval system