KEGG   Scleropages formosus (Asian bonytongue): 108935314Help
Entry
108935314         CDS       T04919                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00590  Arachidonic acid metabolism
sfm01100  Metabolic pathways
sfm04370  VEGF signaling pathway
sfm04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    108935314 (ptgs2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    108935314 (ptgs2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    108935314 (ptgs2)
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108935314 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF Phage_F hEGF
Motif
Other DBs
NCBI-GeneID: 108935314
NCBI-ProteinID: XP_018609334
UniProt: A0A0N8JXG4
LinkDB All DBs
Position
Unknown
AA seq 611 aa AA seqDB search
MIRTVSFVALLLLSLGSLLCEAAGDPCCSQPCQNRGVCTSGGGDQYECDCTRTGYYGQNC
STPEFFTWITTSLKPTPNTVHYILTHFRGFWNIVNNIPFLRDSVMRYVLISRSHLIDSPP
TFNSDYGYKSWEAYSNLSYYTRTLPPVPKDCPTPMGVAGKEALPDAKLVVEKFLLRSKFI
PDPQGTSLMFAFFAQHFTHQFFKSDLKKGAAFTRSLGHGVDLNHIYGETLEKQHKLRLFK
DGKLKYQVLNGEIYPPTVKDVQVEMHYPPHVPEEHRFAVGHEAFGLVPGLMMYATIWLRE
HNRVCDVLKQEHPGWDDERIFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFN
QRFQYQNRISSEFNTLYHWHPLMPDEFHIEGQVYNYQQFLFNNSIVLEHGINNLVESFSK
QIAGRVAGGHNVPAAVAMVATKSVEHSREMRYQSLNNYRKRFNMRPYTSFEELTGDKKMA
SELEELYGDIDAMELYPGLLVEKPRPNAIFGETMVEMGAPYSLKGLMGNAICSPEYWKPS
TFGGNVGFEIIKTASLKKLVCNNVKGPCPVASFQVPDMKNTVSTIINSSTAHSAQSDLKP
TVILKERTSEL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgatcagaaccgtctcttttgtggcgctcctcttactctcactgggctctttgctctgc
gaagccgcgggcgacccatgctgttcccagccgtgccagaaccgcggcgtgtgcacgtcc
ggaggaggcgaccagtacgagtgcgactgcacgcggaccggctactacgggcagaactgc
agcacccctgaattcttcacatggatcacgacttcgctgaaaccgactcccaacacggtg
cactacatcctcacacacttcagaggcttctggaatattgtcaacaacattccctttctg
agggacagcgttatgcgatatgtgttgatatccagatctcatttgatagatagccctcct
acattcaactcagattatggttacaaaagctgggaagcgtattcgaacctctcctattac
acaagaacccttcctccagtgcccaaggattgcccaacacctatgggagttgcagggaag
gaagccctgcctgatgctaagctagtggtggagaagtttcttttgagaagcaagttcatc
ccagacccacagggcacaagcctcatgtttgccttctttgctcagcatttcactcatcag
ttctttaaatctgacctgaagaagggggctgctttcaccagatctttagggcatggggtg
gacttaaaccacatttatggagaaacgttggagaagcaacacaagcttaggcttttcaaa
gatggcaagctaaagtatcaggtactgaatggggagatttatcctccaacagtaaaggat
gtccaagtggagatgcactatcctcctcatgttcctgaggagcaccgttttgcagtgggt
catgaagcctttggcctggtcccaggacttatgatgtatgccacaatctggctgcgggag
cacaatcgagtctgtgatgtgctgaagcaggagcatcccggctgggatgatgagcgcatt
ttccagaccacgaggctcattctaattggcgagaccatcaagattgtgattgaggattat
gtgcagcacctgagtggctaccacttcaagcttaagtttgaccctgagttgctcttcaac
cagcgcttccagtatcagaaccgaatctcatctgaattcaacactctttaccactggcac
cccttgatgccagatgagttccacatcgagggccaggtgtacaactaccagcagttcctc
tttaacaactccatcgtgttagaacatggcatcaacaacctagtggaatccttcagcaag
cagattgcaggcagggttgcgggtggtcataacgtgccggcagctgtggctatggtggct
acaaagtcagttgagcacagccgggagatgcgttatcagtccctgaataactacagaaag
cgcttcaatatgaggccttatacatcttttgaagaattaacaggagataaaaagatggca
tcggagctagaggaattatacggcgatattgatgcgatggagctgtatcctggtcttctt
gtggagaagccaagacccaacgccatctttggagagaccatggtagaaatgggagctccc
tattcactgaaaggactgatgggaaatgctatatgctctccagagtattggaagccaagc
accttcggtgggaatgtcgggtttgaaattatcaaaacagcatcgctgaaaaagctggtt
tgtaacaatgttaagggaccttgcccagtggcatcctttcaagtgcctgatatgaaaaac
actgtgtcaaccataatcaactccagtacagcacattctgcacaaagtgacttaaaacca
actgtcatactgaaagaacgaacatctgagctgtaa

DBGET integrated database retrieval system