KEGG   Scleropages formosus (Asian bonytongue): 108937249Help
Entry
108937249         CDS       T04919                                 

Definition
(RefSeq) alkaline phosphatase-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00730  Thiamine metabolism
sfm00790  Folate biosynthesis
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    108937249
   00790 Folate biosynthesis
    108937249
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     108937249
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108937249
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sfm00537]
 Enzymes
  108937249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sin3_corepress
Motif
Other DBs
NCBI-GeneID: 108937249
NCBI-ProteinID: XP_018612568
UniProt: A0A1W5AGJ5
LinkDB All DBs
Position
Unknown
AA seq 527 aa AA seqDB search
MAYNHSQLITGIFLFITAHLSTSAILQEEQDPSFWNVKGQEALRVALDLKPNVHRAKNLI
LFLGDGMGVTTVTAARILKGQMAGKSGEETTLKMDTFPYVALSKTYNVDQQMPDSAGTGT
AYMCGVKANYGTLGVSAAVKRSDCKMTKGKEVESVLHRARKAGKSVGIVSTARVQHASPA
AGYAHVADRNWYSDADLPADAVNGGCRDIAYQLIHNTDINVILGGGRAYMLPKETNDPEY
SSRTGERLDKRNLITEWLSMKPNSRYVWNKAEFDAVKDWETDYLMGLFEPKDTRYELDRN
NTMDPSLTEMVEKAIKILKKNPEGFYLFVEGGRIDHGHHDSKAKYALTEAVEFDRAIERA
TELTSELDTLFVATADHSHVFSFGGHSPRGNPVLGLSSRIAEDLKPFTTALYGNGPGYKV
INGSREEVNSTVAGSNDYMQQSAVPLDSETHGSEDVVIFAKGPMAHLFHSVQEQSYIAHV
MAYAACIEPYTDCLLPLRDNGQAAPSLSKLFVILLGILPALPSLLLT
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcatacaaccatagccagctgattactggaatatttctttttatcacagctcatttg
tccacttcagcaatcttgcaggaggagcaggaccccagtttctggaatgtgaaagggcag
gaagctctcagggtagcactggacctgaagcccaacgtgcaccgggcaaagaacctcatc
ctcttcctgggggatgggatgggtgtcaccacagtaacggcagctcggatcctcaaagga
cagatggcagggaagtcgggcgaggagaccacactgaaaatggacacctttccttatgtg
gccctgtccaagacctacaatgtagaccagcagatgccggacagtgcgggtacagggaca
gcatacatgtgtggtgtcaaagccaattatggcaccctgggtgtcagcgccgctgtaaaa
agaagtgactgtaaaatgaccaagggcaaagaggtcgagtcggtcctgcacagagccagg
aaggcaggcaagtcggtgggcatcgtctccacagcgcgggtacagcacgcctccccggct
gctggctacgcccacgtggctgaccggaattggtacagcgatgcagacctcccggcagat
gcagtgaacggtggctgccgagacatcgcctaccagctcatccacaatactgacataaat
gtcattttgggaggaggccgtgcctatatgttacccaaggagacaaatgatcctgagtac
tcttccaggacaggagaacgtttagataaaaggaacctcatcacagagtggctcagcatg
aaaccaaattccagatacgtgtggaataaggctgaatttgatgctgtgaaggactgggaa
acagactacctgatgggattatttgagccaaaggacacaagatatgagctggatcgcaat
aatacaatggacccttcgcttacagagatggtagagaaagccatcaagatccttaagaag
aaccccgaagggttctacctctttgttgaagggggaagaatagaccacggtcaccatgac
agcaaggcaaaatacgctttgaccgaggctgtggagttcgaccgagctatcgagagggcg
acggagctgaccagtgagctggacactctttttgtggccactgctgaccactcacacgtg
ttctcatttggagggcattctcccagaggaaatcccgttttaggtttgtctagtcggata
gcagaggacttaaagccattcaccaccgctctgtatggaaatggacccggatacaaagta
attaacggaagtcgcgaagaagtgaacagcactgtggcagggagtaacgattatatgcag
cagtccgccgttccactcgattctgagacccacggttccgaggacgtggtcatctttgct
aagggccccatggcccacctgttccacagtgtgcaggagcagagctatatcgctcacgtc
atggcctatgcggcctgcatcgagccctacaccgactgccttctgccccttagagacaat
ggccaggctgcaccctcgctttccaagctgtttgtcatcctgctgggcatcttgcctgct
ctgccctcgctgctcttaacatga

DBGET integrated database retrieval system