KEGG   Shigella flexneri 2003036: SFy_0105Help
Entry
SFy_0105          CDS       T03267                                 

Definition
(GenBank) FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
sfn  Shigella flexneri 2003036
Pathway
sfn00550  Peptidoglycan biosynthesis
sfn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sfn00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SFy_0105
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SFy_0105
Enzymes [BR:sfn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SFy_0105
Peptidoglycan biosynthesis and degradation proteins [BR:sfn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SFy_0105
Chromosome [BR:sfn03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    SFy_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AIL34029
LinkDB All DBs
Position
89517..91283
Genome map
AA seq 588 aa AA seqDB search
MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWLQVISPDMLVKEGDMR
SLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALANALNIP
LDQLSARINANPKGRFIYLARQVNSDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEAMRNRTIT
DVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALTMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESIVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEFVINQGEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggcgaaaacgcagaaaccaaaacgtcaggaagaacatgccaactttatc
agttggcgttttgcgttgttatgcggctgtattctcctggcgctggcttttctgctcgga
cgcgtagcgtggttacaagttatctccccggatatgctggtgaaagagggcgacatgcgt
tctcttcgcgttcagcaagtttccacctcccgcggcatgattactgaccgttctggtcgc
ccgttagcggtgagcgtgccggtaaaagcgatttgggctgacccgaaagaagtgcatgac
gctggcggtatcagcgtcggtgaccgctggaaggcgctggctaacgcgctcaatattccg
ctggatcagctttctgcccgcattaacgccaacccgaaagggcgctttatttatctggcg
cgtcaggtaaactctgacatggcggactacatcaaaaaactgaaactgccggggattcat
ctgcgtgaagagtctcgccgttactatccgtccggcgaagtgactgctcacctcatcggc
tttactaacgtcgatagtcaagggattgagggcgttgagaagagtttcgataaatggctt
accgggcagccgggtgagcgcattgtgcgtaaagaccgctatggtcgcgtaattgaagat
atttcttctactgacagccaggcagcgcacaacctggcgctgagtattgatgaacgcctg
caggcgctggtttatcgcgaactgaacaacgcggtggcctttaacaaggctgaatctggt
agcgccgtgctggtggatgtcaacacaggtgaagtgctggcgatggctaacagcccgtca
tacaaccctaacaatctgagcggcacgccgaaagaggcgatgcgtaaccgtaccatcacc
gacgtgtttgaaccgggctcaacggttaaaccgatggtggtgatgaccgcgttgcaacgt
ggcgtggtgcgggaaaactcggtactcaataccattccttatcgaattaacggccacgaa
atcaaagacgtggcacgctacagcgaattaaccctgaccggggtattacagaagtcgagt
aacgtcggtgtttccaagctggcgttaacgatgccgtcctcagcgttagtagatacttac
tcacgttttggactgggaaaagcgaccaatttggggttggtcggagaacgcagtggctta
tatcctcaaaaacaacggtggtctgacatagagagggccaccttctctttcggctacggg
ctaatggtaacaccgttacagttagcgcgagtctacgcaactatcggcagctacggcatt
tatcgcccactgtcgattaccaaagttgaccccccggttcccggtgaacgtgtcttcccg
gaatccattgttcgcaccgtggtgcatatgatggaaagcgtggcgctaccaggcggcggc
ggcgtgaaggcggcgattaaaggctatcgtatcgccattaaaaccggtaccgcgaaaaag
gtcgggccggacggtcgctacatcaataaatatattgcttataccgcaggcgttgcgcct
gcgagtcagccgcgcttcgcgctggttgttgttatcaacgatccgcaggcgggtaaatac
tacggcggcgccgtttccgcgccggtctttggtgccatcatgggcggcgtattgcgtacc
atgaacatcgagccggatgcgctgacaacgggcgataaaaatgaatttgtgattaatcaa
ggcgaggggacaggtggcagatcgtaa

DBGET integrated database retrieval system