KEGG   Chania multitudinisentens: Z042_13770Help
Entry
Z042_13770        CDS       T02987                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
sfo  Chania multitudinisentens
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Z042_13770
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Z042_13770
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Z042_13770
   00430 Taurine and hypotaurine metabolism
    Z042_13770
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Z042_13770
Enzymes [BR:sfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Z042_13770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(519405..520805)
Genome map
AA seq 466 aa AA seqDB search
MDKTNVFTNYNENDDVYASIDLAKSMPKSVFPAEERNPRNVFNAIRDELMLDGNSRQNLA
TFCQTWVDDEIRELMDLSIDKNMIDKDEYPQTAEIEARCVRMLADLWNSPTPETTLGCST
IGSSEAAMLGGLALKWQWRKKRAEQGLTADKPNLICGPVQICWHKFARYFDVELREIPLE
GDRLIMSPEEVLKRVDENTIGVVPTLGVTFTCQYEPVKAVSDALDKLQNETGLDIPMHVD
GASGGFLAPFCVPELEWDFRLPRVKSINTSGHKFGLAPLGAGWIVWREVSDLPEELIFNV
NYLGGNMPTFALNFSRPGGQIVAQYYNFLRLGREGYAKIHNACYATAQYLAEEIGKIGPF
EILFDGDSSKGIPALAWKLKDNAALGGYNLYDLADKLRSRGWQVPAYSMPAHREDLVIQR
ILVRHGVSYDLGCLLIDDIKRALDYFANHPVTHPLSEEEASGFNHG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggataagactaacgtatttaccaattacaatgaaaatgatgatgtttacgcctccatt
gatttggcgaaatcaatgccgaaatccgttttcccggctgaagaacgtaatccccgtaat
gtttttaatgctattcgtgatgaactcatgctggacggtaattcacgccagaatctggca
acattttgtcagacgtgggtagatgacgagattcgcgaattaatggatttatcgatcgac
aaaaatatgatcgataaagatgaatatccgcaaaccgcagagattgaagcacgttgtgta
agaatgctggctgatttatggaattcaccgacaccggaaacgacgttgggctgctccacc
atcggttcatctgaagccgcgatgctaggtgggctggccctgaaatggcaatggcgtaaa
aaacgtgccgaacagggattaaccgccgataaaccgaacctgatttgtgggccagtacag
atttgctggcataaatttgcccgttactttgacgttgaactgcgtgaaatcccgctggaa
ggcgatcgcctgatcatgagcccggaagaagtgctcaaacgtgttgatgaaaataccatt
ggcgtggtgcccacattgggtgtgacatttacttgccagtacgagccggttaaagcggtc
agcgatgcccttgataaactgcaaaacgaaaccggtctggatattcccatgcacgttgat
ggcgcgagcggcggctttctggccccgttctgtgtacctgagctggaatgggatttccgc
ttgccgcgggtgaaatccatcaatacttccggccataaatttggtttggccccattgggt
gcgggctggatagtgtggcgagaagtgtctgacttgcctgaagaacttatcttcaatgtc
aactatcttggcggcaacatgcctacttttgccttgaacttctcacgtcctggcgggcag
atcgttgcacagtactataattttttgcgtcttggccgtgaaggctacgcgaaaatccac
aatgcgtgctatgccacggcgcagtatctggccgaagaaatcggcaaaatagggccattt
gaaattctgtttgacggtgacagcagtaaaggcatccctgcgctggcgtggaaactgaaa
gataatgcggcactgggtggctacaacctttatgacctggccgacaaattacgttcccgt
ggctggcaggttccggcgtattccatgccagcacatcgtgaagatctggtgattcaacgt
attctggttcgtcatggtgtgagctacgatctcggttgcctgctgattgatgatattaaa
agagcgctagactatttcgcaaaccacccggttacgcaccctctaagtgaagaagaagcg
agtggttttaaccacgggtaa

DBGET integrated database retrieval system