KEGG   Shewanella frigidimarina: Sfri_1887Help
Entry
Sfri_1887         CDS       T00395                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sfr  Shewanella frigidimarina
Brite
Enzymes [BR:sfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Sfri_1887
Peptidases [BR:sfr01002]
 Metallo Peptidases
  Family M2
   Sfri_1887
Exosome [BR:sfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sfri_1887
CD molecules [BR:sfr04090]
 Proteins
  Sfri_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2230607..2232448)
Genome map
AA seq 613 aa AA seqDB search
MNLPLKRPSQIALIVSIALGLSACNDTQEPAPAPVEKIDATAAINFINQAEADLADLSIE
ANRAEWIYSNFITDDTAALSAAMGEKVTSTSVRYATEAAKYANVELDAVNARKLNSLRSS
LVLPAPLDPAKNAELASIASELNGLYGKGKYCFADGRCLTQPELSNLMAESKDPAVLLEA
WQGWREIAKPMRPLFEREVELANQGAQDLGYADLSELWRSQYDMEPEAFSAELDRLWAQI
KPLYDSLHCYVRGELNQQYGDDVAPKTGPIPAHLLGNMWAQQWGTIYNNVAPKDADPGYN
VTELLAKNGYDEIKMVKQAEGFFTSLGFGELPESFWTRSMFVQPQDRDVVCHASAWDLDN
LDDIRIKMCIQKNAEDFTVIHHELGHNFYQRAYKNQPFIFKNSANDGFHEAIGDTIALSI
TPKYLQKIGLLETVPDASKDIGLLLKQALDKIAFMPFGLMIDQWRWQVFNGTIKPDQYNQ
AWWDLREKYQGVKAPIERTEADFDPGAKYHVPGNVPYTRYFLAHVLQFQFHKALCDIAGD
TGPVHRCSIYGNKEAGAKLNEMLEMGASKPWPEALSVVTGSDKMDAKAVLDYFAPLQVWL
DEQNTQANRQCGW
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgcctttaaaacgaccgtctcaaattgcactaattgtctcaatagcattagga
ttaagtgcctgtaatgacactcaagagcctgctcccgctccagttgaaaaaattgatgcc
actgcagcaattaatttcattaaccaagcagaagccgatttagcggatttgtcgattgaa
gctaatcgtgcggaatggatttattccaattttatcactgacgacaccgcggctttatct
gccgcaatgggtgaaaaagtcacttcaacatctgtgcgctatgcaacagaagcggcaaaa
tatgccaatgtagaacttgatgccgttaatgccagaaaacttaacagcttacgcagcagc
cttgttttacctgccccgctagacccagctaagaacgcagaacttgcgagtatcgcatct
gaactcaacggtctatatggtaaaggaaaatattgttttgctgatggtcgctgtttaact
caaccagagctatcaaaccttatggcggagtctaaagatcccgcggtacttttagaagct
tggcaaggttggcgtgaaatagcaaaaccaatgcgtccactatttgaacgtgaagtcgaa
ttagccaatcaaggcgcgcaagatttaggttacgccgacttatctgaattatggcgtagt
cagtatgacatggagccagaagcattctctgccgaattagaccgcctatgggcacaaatt
aagcctttatatgattcattacattgttatgtgcgtggtgaattaaaccagcagtacggt
gatgatgttgcgcctaagacgggccctatccctgcacatttattgggcaacatgtgggct
cagcaatggggcacgatttataacaacgtagcgcctaaagatgctgatcccggatacaat
gttaccgaactgttagctaaaaatggctatgacgaaattaaaatggtcaaacaagctgaa
ggtttcttcacttcacttggctttggcgagctgccagaatcgttttggactcgctcaatg
tttgttcaaccgcaagaccgtgatgtagtgtgtcatgcatctgcgtgggacttagataat
ctggatgatatccgcataaaaatgtgtatccagaaaaacgctgaagattttaccgtcatt
catcacgaattaggccataacttctatcaacgcgcttataaaaatcagccgtttatcttt
aaaaactctgccaacgatggtttccatgaagccattggtgacacgattgcgttatcaatt
acacctaaatatttacaaaaaatcggattactcgaaactgtacctgatgcatcaaaagac
attggtttattgttaaaacaagcattagataaaattgcctttatgccttttggtttaatg
attgaccaatggcgctggcaagtatttaacggcaccattaaacctgatcaatataatcaa
gcttggtgggacttacgcgaaaaataccaaggtgttaaagcgccaattgaacgtacagaa
gccgattttgatcctggtgctaaataccatgtaccaggcaatgttccttatacacgttat
ttcttagcacatgtgttgcagttccaattccacaaagcactgtgtgatattgcaggagac
accggcccagttcatcgctgtagcatttatggaaataaagaagctggggctaagttgaat
gaaatgctcgaaatgggcgccagcaaaccttggccggaagcactgagtgttgtgactggg
tctgataaaatggatgccaaggcagtattagattactttgcaccattgcaagtgtggtta
gatgagcaaaatacccaagctaatcgccagtgtggctggtaa

DBGET integrated database retrieval system