KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_0314Help
Entry
SFyv_0314         CDS       T03315                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00730  Thiamine metabolism
sfs00790  Folate biosynthesis
sfs01100  Metabolic pathways
sfs02020  Two-component system
Module
sfs_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sfs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SFyv_0314
   00790 Folate biosynthesis
    SFyv_0314
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SFyv_0314
Enzymes [BR:sfs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SFyv_0314
Exosome [BR:sfs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SFyv_0314
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sfs00537]
 Enzymes
  SFyv_0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AIL39075
LinkDB All DBs
Position
complement(252672..254087)
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTDVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVNDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGN
IDKPAVTYTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQVVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggattcggaaatt
actgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaactggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaaccgatgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcacatgtgacttcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgct
cgtgccgacgttacgcttggcggcggcgcaaaaacctttgctgaaacggcaaccgctggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgaac
gatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctgcttggcctg
tttgctgacggcaatatgccagtgcgctggctagggccgaaagcaacgtaccacggcaat
atcgataagcccgcagtcacctatacgcctaatccgcaacgtaatgacagtgtaccaacc
ctggcacagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggatttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaacccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaag
gagggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccaggttgttgcg
ccggataccaaagcgccgggcctcactcaggcgctaaatactaaagatggcgcagtgatg
gtgatgagttacgggaattccgaagaggattcacaagaacataccggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system