KEGG   Syntrophobacter fumaroxidans: Sfum_1475Help
Entry
Sfum_1475         CDS       T00418                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00010  Glycolysis / Gluconeogenesis
sfu00230  Purine metabolism
sfu00620  Pyruvate metabolism
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
sfu01120  Microbial metabolism in diverse environments
sfu01130  Biosynthesis of antibiotics
sfu01200  Carbon metabolism
sfu01230  Biosynthesis of amino acids
Module
sfu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sfu_M00002  Glycolysis, core module involving three-carbon compounds
sfu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sfu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_1475
   00620 Pyruvate metabolism
    Sfum_1475
  Nucleotide metabolism
   00230 Purine metabolism
    Sfum_1475
Enzymes [BR:sfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Sfum_1475
Membrane trafficking [BR:sfu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Sfum_1475
Exosome [BR:sfu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Sfum_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABK17164
JGI: Sfum1475
UniProt: A0LIB2
LinkDB All DBs
Position
1830871..1832316
Genome map
AA seq 481 aa AA seqDB search
MTLPLNKTKIVCTIGPASRSPEVMQSLLLAGMNVARLNFSHGDFSGHKGVIEDLRAAAAA
TGRRIAIMADLPGPKMRIGRFGSEPIDLKPGDLFTLTTDDVPGDERKVSVSFSPLPRVVR
PGDTLYLNDGLIQVDVDRVRDSDVDCRVVVGGELRSCKGLNLPGIDLGISAFTEHDHNCL
KFALENGVDAVSQSFVESPEDIRAVRNAAAALGYRPFIIAKIERSRALDHLDDIITAADA
VMIARGDLGVELPIEQIPVVQKQITRAANMRARPVITATQMLESMTANRRPTRAEATDVA
NAILDGSDCVMLSGESAMGAYPVDSVATLARIAAAIEPHRPMVSARDLFRGIELKGRVPA
ARLIDLSVETVLEYADPAAVFVPTHRGDTARSIARFRLPAWIIAVSSEEATCRQLQFSSG
VYPVCEARHPDNWNAYVSDWLKAHGMEGNLAVVTEGPSRRYPDANNRLEIVNMAWPEEMD
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacactgccgctcaacaagaccaaaatcgtatgcaccatagggcccgcttcgcgttcc
ccggaggtgatgcagtcgctgctgctggccggcatgaacgtcgcgcggctcaatttctcg
cacggtgatttctcgggtcacaaaggggtgatcgaagatctccgggccgcggccgccgcc
accggccgtcgcattgccatcatggcggaccttcccggcccgaagatgcgcatcggcagg
ttcggttccgaaccgatcgacctgaaaccgggggacctgttcaccctcacgaccgacgac
gtgcccggagacgaacgcaaggtctccgtcagcttctcccctctcccccgggtcgtcaga
cccggcgacacgctctacctgaacgacggcctgatccaggtggatgtggaccgggtgcgg
gacagcgacgtcgactgccgcgtcgtggtcggcggtgagctgcgctcgtgcaaggggctc
aacctcccgggcatcgacctgggcatcagcgccttcaccgaacacgaccacaactgcttg
aaattcgctctcgagaacggtgtcgacgcggtgagccagtcgttcgtcgagagcccggag
gacatccgggcggtgaggaacgcggcggcggccctgggctaccgtcccttcatcatcgcc
aagatcgaacgatccagggcgctcgatcatctcgacgacatcatcaccgcggcggacgcc
gtcatgatcgcgcgaggcgacctgggcgtggagctccccatcgagcagatccccgtggtt
cagaaacagatcacgcgcgcggcgaacatgcgcgccaggccggtcatcaccgcgacgcag
atgctggaatccatgacggccaaccggcgccccacccgcgcggaggcgaccgatgtggcc
aacgcgatcctcgatggctcggactgcgtcatgctctcgggcgagtcggccatgggcgcc
tatcccgtcgactcggtcgcgacccttgccaggatcgccgccgccatcgagccgcaccgc
ccgatggtcagcgccagagacctgttcaggggcatcgagctcaagggcagggtgcccgcg
gcaaggctgatcgacctcagtgtggagaccgtcctggagtacgccgacccggccgccgtc
ttcgtccccacgcaccgcggagacacggccaggagcatcgcccggttccgcctcccggcg
tggatcattgccgtcagctcggaggaagccacgtgccggcagctccagttttcctcgggt
gtctaccccgtatgcgaggcccggcaccccgacaactggaacgcctacgtgtcggactgg
ctcaaggctcacgggatggaaggaaatctcgctgtggtgaccgaaggcccttcgaggcgc
tatcccgacgccaacaaccgcctcgagatcgtgaacatggcctggccggaagagatggac
ggatga

DBGET integrated database retrieval system