KEGG   Streptococcus gallolyticus UCN34: GALLO_0650Help
Entry
GALLO_0650        CDS       T01171                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
sga00473  D-Alanine metabolism
sga00550  Peptidoglycan biosynthesis
sga01100  Metabolic pathways
sga01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    GALLO_0650 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GALLO_0650 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    GALLO_0650 (ddl)
Enzymes [BR:sga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GALLO_0650 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sga01011]
 Precursor biosynthesis
  Amino acid ligase
   GALLO_0650 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CBI13142
LinkDB All DBs
Position
673527..674573
Genome map
AA seq 348 aa AA seqDB search
MAKETLVLLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFITQSGDFIKTQEFSSKPA
DDEKLMTNATVVESQKIKPSDIYEEGAVVFPVLHGPMGEDGSIQGFLEILKMPYVGTNIL
SSSVAMDKISTKHVLESAGVPLVAYVTYVEGADLEKAVTEVNEKLTYPVFVKPANMGSSV
GISKADDEEGLRSAIDLALKYDSRILIETGVNAREIEVGILGNADVQTTLPGEVVKDVAF
YDYDAKYIDNKITMDIPAHIDSSIMEEMRGYATTAFRAIGGCGLSRCDFFLTEDGHVYLN
ELNTMPGFTQWSMYPLLWENMGLAYSDLIEKLVELAKEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaacgcttgttttactttatggtggacgttctgcggagcgtgaagtatct
gttttatcagctgagagtgtcatgcgtgcgattaattatgacaaattctttgtgaaaact
tacttcatcacacaatctggtgattttattaagacacaagaattttcaagcaaaccagcc
gatgatgaaaaattaatgactaacgctactgtcgttgaaagtcaaaaaattaaaccaagt
gatatttatgaagaaggagcggttgttttccctgttcttcatggaccaatgggagaagac
ggttcaatccaaggcttccttgaaattcttaaaatgccttacgttggaactaacatcttg
tcatcaagtgttgccatggataaaatttcaacaaaacacgttcttgagtctgcaggtgta
ccacttgttgcttacgtgacttatgttgaaggggctgaccttgaaaaagcggttactgaa
gtaaatgaaaaattgacttacccagtctttgttaaaccagccaacatggggtcttcagta
ggaatttcaaaagctgatgatgaagaggggctccgctcagctattgacctcgcccttaaa
tacgatagccgtattcttatcgaaactggtgtcaatgcgcgtgaaatcgaagttgggatt
ttgggaaatgctgacgtgcaaacaacattacctggtgaagttgttaaagacgttgctttc
tatgattacgatgctaaatatatcgacaataaaattactatggatattccagcgcatatc
gatagcagcattatggaagaaatgcgtggctatgcaacaacagctttccgtgctatcggt
ggatgtggtttgtcacgttgtgatttcttcttgacagaagatggtcatgtttaccttaac
gaattgaatacaatgccaggtttcacacaatggtcaatgtatccacttctttgggaaaat
atgggacttgcttattctgatttgattgagaaattggttgaattagctaaagaaatgttt
gaaaaacgcgaaagccatttgatttaa

DBGET integrated database retrieval system