KEGG   Streptomyces globisporus: WQO_18650Help
Entry
WQO_18650         CDS       T04209                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
sgb  Streptomyces globisporus
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgb00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    WQO_18650
Enzymes [BR:sgb01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     WQO_18650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4264710..4265954
Genome map
AA seq 414 aa AA seqDB search
MSETTTTATTTAEDLRARALKLDAADPLAGRRELFALDDGVYLDGNSLGALPVHVPARVQ
DVLTRQWGELRIRSWDESGWWTAPERIGDRIAPLVGAAAGQIVVGDSTSVNVFKAVVAAA
RIAGEGRDEILVDATTFPTDGYIAASAARLTGHRLVPVDPADVPAALGPRTAVALLNHVD
YRFGRLHDLPGLTAAVHAAGAVAVWDLCHTAGALPVGLDEHGVDLAVGCTYKYLNGGPGS
PAYLYVAERHQAAFDSPLPGWNSHADPFGMTPGYVPADGSVRGRVGTPDIVSMLTLDAAL
DVWDGVSVDTVRAKSLALTDFFLECVEAYVPAGRVTSVTPSAHAERGSQVALRCEDAEPV
MRRLIERGVVGDLRRPGVLRFGFTPLYVGFADAERAARVLAEVLAEIPPSGPAA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaccacgaccaccgccacgaccacggcggaggacctccgcgcgcgggcgctg
aagctcgacgccgccgatccgctcgccggccgccgcgagctcttcgcgctcgacgacggc
gtctacctcgacggcaactcgctgggcgcgctgcccgtccacgtccccgcccgggtgcag
gacgtcctcacccgccagtggggcgagctgcgcatccggtcctgggacgagagcggctgg
tggaccgcgcccgagcggatcggcgaccggatcgcgccgctcgtcggggccgccgccggg
cagatcgtcgtcggggactcgaccagcgtgaacgtcttcaaggccgtcgtcgccgcggcc
cggatcgcgggcgagggacgcgacgagatcctggttgacgcgacgacctttcccacggac
gggtacatcgcggcgtccgccgcccggctcaccggccaccggctggtgcccgtggacccg
gccgacgtaccggccgcgctcggtccccgtaccgccgtggccctgctcaaccacgtcgac
taccgcttcggccggctgcacgacctgcccgggctgaccgccgccgtccacgcggcgggc
gcggtcgcggtgtgggacctctgccacaccgcgggcgcgctgcccgtcgggctcgacgag
cacggggtggacctggcggtcggctgtacgtacaagtacctcaacggcggccccggttcg
cccgcgtacctgtacgtcgccgagcgccaccaggccgccttcgactcgccgctgccgggc
tggaactcgcacgccgacccgttcggcatgacccccggctacgtcccggcggacggttcc
gtacggggccgggtcggcacccccgacatcgtctccatgctgacgctggatgcggcgctc
gacgtgtgggacggggtgtcggtggacaccgtacgggccaagtccctggcgctgacggac
ttcttcctggagtgcgtcgaggcgtacgttccggcgggccgggtcacctccgtcactccg
tccgcgcacgccgaacgcggcagtcaggtcgctctgcgctgcgaggacgccgagcccgtg
atgcgccgcctcattgagcggggcgtcgtcggcgacctgcgccggccgggcgtgctgcgg
ttcggcttcaccccgctgtacgtcggattcgccgacgcggaacgggcggcgcgggtactg
gccgaggtgctggcggagatcccgccgtccggcccggcggcctga

DBGET integrated database retrieval system