KEGG   Sinocyclocheilus grahami: 107554881Help
Entry
107554881         CDS       T04918                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
sgh  Sinocyclocheilus grahami
Brite
Enzymes [BR:sgh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107554881
Cell adhesion molecules and their ligands [BR:sgh04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     107554881
   VLA-5
     107554881
   VLA-9
     107554881
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 678 aa AA seqDB search
MALDISTWDLACRFNNTDHHTELNGMDRLIVRRGQAFTINLYLNSGSYQPGYSQLHITAE
TGPQPEEQYGTRAVFGLSDEIDDTRWSAAVSSPTGDTVCLSVCAAPDAPIGRYVLTLDGR
IQFDFILLFNPWCPRDVVYIDSEEKLAEYVLAQDGIIFRGNAEYPVPIAWYFGQFEEGIL
DACLRILDMNPKHSRNPGKDCSGRRNVIYVTRVLSAMINSNDRDYGVLEGCWKDTFDGGV
SPMSWRGSVQILRTWSSTSCLPVRFGQCWVFAAVACTVSRALGIPCRVVTNFYSAHDTNS
NLVIERYLNEKGEIDSSTRDMIWNYHCWVESWMTRPDLPPGFDGWQASDPTPQEKSEGVF
CCGPVPVRAIKEGELTFKYDAPFVFAEVNADLVHILKYNDGSTRKIVNDQKVGQKISTKS
VGRDEREDITHLYKYPEGSAEERQVFEKANHQNKLQQQQANPGLQITIKLSTGIRKGCDF
DVFAIVTNNTEEDKKCRLVFASRAVSYNGVIGRECGFKDLLNVALAPGGERKVPLKLNYS
KYCTNLTEDNLIRLGALLIDYSTKEAMMAMRDIVLDDPEIKIRILGEPKEKRKLAAELTL
QNPLPETLQGCCFTIEGANLTGGSSITEKLESPIEPGQEAKVKIYFTPTQSGLRKLVVDF
DSNKLGHVRGYKNVIIGK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggctctggacatcagcacctgggatctggcgtgtcggttcaataacacggatcaccac
acggagctgaacggcatggatcggctgatcgtacggagaggacaggccttcaccatcaac
ctgtacctgaactccggctcttaccagcccggatacagccagctgcacatcactgcagag
acaggccctcagccggaagagcagtatggcaccagggccgtgttcggcctcagcgatgag
atcgacgacacgcgctggagcgcagcggtcagcagtccaaccggagacactgtttgtctt
tctgtctgcgccgctcctgacgctcccatcggccggtacgtcctgactctagatgggcgc
atccagttcgacttcatactgctcttcaatccctggtgcccacgagatgtggtctacata
gacagcgaggagaaactggcagagtatgttctggctcaggatgggatcatcttcaggggc
aatgccgaatacccagtccccatagcctggtattttggacagttcgaggagggcatactg
gacgcttgtttgagaatcctggacatgaaccctaaacacagtaggaaccctgggaaggac
tgttctggacgcagaaacgtcatttatgtcacaagagtgctgagtgctatgatcaacagc
aatgaccgggactacggcgtgctggagggctgctggaaggacacgtttgacggcggcgtg
agccccatgtcctggagaggaagcgttcagatcctgagaacgtggagcagcacttcctgt
ctgccggtgcgcttcggccagtgctgggtgttcgcagctgtcgcctgtacagtgtctcgt
gctctgggaatcccatgcagggtggtaacaaacttctattccgcccatgataccaacagc
aaccttgtaatcgagcgttatctcaacgagaaaggagaaatagacagcagcaccagagat
atgatatggaactaccactgctgggtcgagagctggatgacgcgacctgatctccctccg
ggttttgacggctggcaagcgagtgacccgacgccgcaggagaaaagtgaaggtgtgttc
tgctgcgggccggttcctgtacgggcgataaaagagggagagctcaccttcaaatacgac
gctccgtttgtgttcgcggaggtgaacgcagacttagtgcacatcctgaagtataacgat
gggagcacaaggaaaatcgtgaatgaccaaaaagtggggcagaagatcagcaccaagagc
gtaggccgagatgagagagaagacatcacacacctgtacaaatatcctgaaggttctgcg
gaggagaggcaggttttcgagaaagcaaaccaccagaacaagctgcagcagcagcaagcg
aaccctgggctgcaaatcaccatcaagctgtcgacggggatcaggaagggctgcgacttt
gacgtctttgcaatcgtgaccaataacaccgaggaggataagaagtgccgtctggtgttt
gcgtcacgcgccgtgtcgtataacggcgtcatcgggcgcgagtgcggtttcaaagacctg
ctcaatgtggcgctagcacctggaggagagaggaaggttcctctaaagctgaactacagt
aaatactgtactaatctgacggaggacaatctcatccgtctgggcgctctgctgatcgac
tacagcaccaaggaagccatgatggccatgcgtgacatcgtgctggacgaccccgagatc
aaaatcaggattctgggagaacccaaagagaagcgtaagctggcggcagagctcacccta
cagaacccgctgccagaaaccttacaaggctgctgcttcaccatcgagggagcaaacctc
accggcggcagcagcatcaccgagaaactggagtcacccatcgaacccgggcaggaggcc
aaagtcaaaatctacttcactcccactcagtccggcctgcgcaaactcgtggtggatttt
gacagcaacaagctgggccacgttagaggatacaagaacgttatcatcgggaaatga

DBGET integrated database retrieval system