KEGG   Sinocyclocheilus grahami: 107571391Help
Entry
107571391         CDS       T04918                                 

Gene name
kmt2b
Definition
(RefSeq) histone-lysine N-methyltransferase 2B isoform X1
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107571391 (kmt2b)
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107571391 (kmt2b)
Transcription factors [BR:sgh03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    107571391 (kmt2b)
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107571391 (kmt2b)
   HMT complexes
    MLL3/MLL4 complex
     107571391 (kmt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H Pox_EPC_I2-L1
Motif
Other DBs
NCBI-GeneID: 107571391
NCBI-ProteinID: XP_016113199
LinkDB All DBs
Position
Unknown
AA seq 3766 aa AA seqDB search
MMAAAGCGSATAAAVVGAARGRFPGRPWSSRSRLRSEKRWQLGRSGTDLDEISSNGGPRP
TCLVLALNEDQSHLRLLGLEESYKSLGEAGYSSSGSEEGAEFKGFEVQDENSSAPVRAGR
KSCKRDRVSAKSSKRIRQRRALPVSPLVGSTGSQDPQNDSGSVQQLHSQESLKDTSVDDG
GGGDGGSEKCTRRKRGLTKQKTQSTPRITIKLLAKKKVVTVPSVQRKSGKKQKEIKSEVT
ESQCAQISSAHVKLKTNVAASECSASEAKEEVCTRRRGRSADKKLESTPQTNPEKEGNEQ
KLKLRKSTRRSQNPLPSENIESKPDEKSAIEASEVNKLVIMRQRRRSSNVPQESRDQSLV
ESMLEVSTIDESRPLSKKKKDKKKKKKKNRKESERKPEPHSPSAKDLGPSADDPQKLAFD
NDFVGIPGLKLTRIRNPKARSRKKRCKFVWTLTLVKSKSKDSQIQENLSNTQESKSKDSQ
VQDDLSKTQEIKSQDSQIQESQSKVDESPSTEAELPPKCDEEVDVSTEAESTSTPSNILE
TGSSQESQNVENTVGAVIPESTENPVAIEKVEETPEKESKGVLERSEIATEAHPEEATQT
DPEDLISKDAVPPLQIKVVSSPGKKNCLKQSFLIQQVTTSPERKEPSKVEDPQHSEKSEN
VLEITAAAPTPKVRKRQHQNTARKKRAKHKHWTIYRRKCKLNASQENPASETETESQVEE
SSVSPTAVPAPVESKPNRHSSEVMHKIGKRSAPPTIEPLPEAAKPQVIEQTVEPPPTNPF
LGTEPQPEIKLEAPSIETEEVLVLEPSVKDHPQVPRPSRRRIKRVKRRRKSLIGRRIKNS
KLQKKELFEVSNDFPPITSSRKSSSEVEEPKLFGIFSTKYKRKRISRLQSLEGRRKKAKL
LSKQLDNTNGDQLSDQTERDSVIVKTDRDQDIQQSKTKFMKTIRHFIMPVVSARSSRVIK
TPKRFMDDLGMSGLPRKNSQKKLGLQPKSKKRDSSEKGEPESFQFKDEDNDLSEADLDLS
STWESKPKSPNDAEIFSEEKQPGKRRSLLRDPSFKWGVLEPASDDVYAFNEDLDKELDTL
LSAKAFTVDPFLDPIQKKKKSTKFKVQSSKLRLYKKLKLKQSLARRKKTPKDKMIQVVSS
PAKTQKEELEEGASLIKSLKDMKKEKAKLKIEDLNTPGVVRKVSICVRALSAKLLAQHQA
KDIQEDDLPDEFSIHTDISLPNKCKDFDEMHHADSEGPVSEGTPKHAADVEEKTAIQHPR
LTGVNKRMFNLLKKAKVQLIKIDQQKQLKSSGLLPMGRITATKRPRRKPKERLENACANK
TEASPEQEPARGGPRIKHVCRAAAVVLGQPRAMVPDDIPRLSALPLHERSDISPSPAEKG
VESHSDPESPVLQEHRTPKFRRGRAHLFGNRSRRCGECKGCLHEEDCGRCINCLDKPKFG
GPNTKRQCCIYKRCDQVEERKALRLSGKLQKGYVKKRRSSISAGHSSNEECEGSDGIGRM
FPASLGDSPSVRKQPRRHVKPRSYCDLLDYDSDFDWIGGSNSTSPARRRTPGLRNSDFVS
FDDFIGDAFDEGVRHRRPSFHKVPPIKRKVEKSPQDQTPPSVLAALANGFAEREQEPAEP
THKIRVDFKEDCSVQSVWATGGLSILTSVPLVPQYVCLLCASKGQHEMLYCQVCCEPFHH
FCLDPSERPLEENKENWCCRRCKFCRVCGCKNKESKPLLECERCQNCYHPACLGPNYPKP
NKRKKPWVCMTCIRCKSCGVTPGKSWDTEWNHDKGLCPDCTRLFDQGNYCTMCFKCYEDN
DYDSQMMQCSTCNHWVHAKCEGLTDDLYEILSSLPESVVYSCQPCLQEQPDGEDVNGAGW
RELLDHELKTGLERVLSCLLSSSLTKHLVTCKKCTTVGSLNTVDGNLPVCDFRAIGKKFD
EGLYTSLKSFHEDVVTVIRNYLEDEEFLPEDQRPTALSRSYYLKLLEEVYAWFNSQDPKI
WDPRSKHLPAGMLSHAVMPPNYEHVYAQWRERDGCHKALDGAPQSTGRHMDVKLGEEEDV
STPLAHNPKGYFMDTRALQMNLKGKKGRPAKSDLDTGLDDERQCALCQKYGDAKASDAGR
LLYLGQNEWAHVNCTMWSAEVFEEDNGSLLHVHSAVARGRLMRCERCNRTGATVGCCLTS
CQSNYHFMCARFRNCVFQNDKRVFCHKHRDLISGKIITGQGFEVLRRVYVDFEGISFRRK
FLTGLEPESINLMIGSLLVKKLGKLSELSACHGKLFPVGYECSRWYWSTVNPLRRCKYTF
RVREVRPTVQEKPVEESPDHGENCTIAHSPWPQSESEAPGVDLSSTNPSTETNSTSVSVF
AKPDIGARPKIPLYPQNRRPAGGLSRPLPSPGAAPSKPHHILTISDLDDTRRPRRHSPHT
QNIGTRSHMTSPTLGSPAAPIASRAGGSHHPKTSQPTSPVFPLGATENLLTSSSARPVGR
SASSVRGSGILTPHSTSGLFSQSTRQGGISSTPCTNQSLTSPTHLSTRPMPFDFNQIDSV
ELPHNFIASPREHPAENGALPLLGDTLGTQKGNHLGRDRDFPYTSFHLEADLTVAPELRT
ELEIEETELNEGVAMNCSAQIVVEGEDNQEDFWEPDEEKSKMSTQRLSCTVDPCREDWGN
SSSDEDMENYINFTRTVVTCKAQRDASQSSTSPSPSLRQISQLDGVDDGTESDTSVANNE
NQGVKLSNQAQKPHKPFNAVPHEQTASNGLCLAFPSPVSDFSLIQLEPVSNSETVADQDY
FGVTQTLQSSQDPLTNFVDQKPSNTAFSTYGNDYQTPHLMVEPETPLIFERCDPLSPNAH
FTELVPVQDSLSDPPDSKELYLDPSSGHFVSSMADSRVYQNNHLQDDSPDLMEVNGIQNL
QQQNPVPFTVLPKSASFSELLSSDSSAHVSFATFPNQAPSANVSLYPVQTPEGKTVLPPM
ESFRTKLHPPAEPSHGGAMPCIPTNLPQKPESMLSVPSATGVPLGTYGPVSGTVSVPLHP
TYPQPIGSTTVGMISSSVTSQPSAQCQAMPSAIQPVSAPGVINGYNTTPMQRETALGRTI
SINFSTPRSTIEPQQQLVTQALPGHAILTVKEVGGPNVDPTPHVLLVNRLGQIFVKNPES
NTFQLPTPNSPSYNCVTQIASLLQSNALSATLAAAGNLTPVAGATIPTQVPQIVTPLVQT
SNTITQLLTTSTNGAASIPADVKKPRRNAKASGDRLKKPRNKESSTPRRTKSASTHGPSS
KQSTSQIVTSSDISNQADCAQAIINQAMAGYYDPNKTVSLIPSSPRNTTIIGQTQTTSSV
LPEGLLVEPEMKASPPATPEAAPRPKQVRMKRVSSLSDRFTTKKSKSDFLDLDRPSGLEE
PRKSNSVSARYGVRIKTPTIKGILDCDKLNEERSSDSESARPGPWDRLSLPRGGDSNKPA
TWDPTNRNALSDWNKYSGMLSCSDDEMPPSDGEEHSPPSRDQPHLRFEIASDDGFSVEAD
SIEVAWSAVIEGVQEARAVAGLRQLTFSGMSGARVMGMLYDAIVYLVEQLQGANRCQRHT
FRFHKQASQEEDLPVNPSGCARSEVYLRKSTFDMFNFLASQHRQLPDTDLYDEEEDEVLL
KSTRRATSLELPMAMRFRHLEKTSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYSGIVI
RSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGQ
KHIVIFALRKIYRGEELTYDYKFPIEDASNKLGCNCGAKRCRRFLN
NT seq 11301 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggcagcgggatgcggatcagcaaccgcggctgccgttgtgggcgcggcgcgg
ggtcgcttccccggtcggccttggtcgtcgcggagccgtttgcgttcggagaagcgatgg
cagctcggccgctcagggacagatcttgacgagatctcctccaacggaggcccgaggccc
acctgcctggtgctcgcgctgaacgaggaccagtctcacttgcgccttctcgggcttgag
gagagctacaagagcctgggagaggctggatacagctcgagtgggagcgaagagggagct
gaattcaaaggctttgaagttcaagatgaaaatagcagtgccccggttcgtgctggacga
aaatcatgtaaacgtgatcgtgtttcagcaaagtcgtcaaagaggatacgtcaaaggcgg
gctcttccagtgtcccctttagtgggaagcacaggttcacaagatcctcaaaatgattca
ggttctgttcagcaactccacagtcaagagtctctgaaggacacatcagtagatgatggt
gggggtggtgatggaggatcagagaagtgcaccaggagaaaaagaggattgacaaaacaa
aagacccagtcgactccgagaatcacaatcaagttgttggctaaaaagaaagtggttaca
gtcccgtcagtgcaacgtaaatctggtaaaaaacaaaaggaaatcaaatctgaagttaca
gagagtcagtgtgcccaaatctcaagtgctcatgtgaaattaaagacaaatgtagcagcc
agtgaatgcagtgctagtgaggcaaaggaggaggtttgcactagaaggcgaggaagatct
gctgacaaaaaattagaatccactccacaaacaaatcctgaaaaagagggcaatgagcaa
aaactgaagctgaggaaatcaactcgaaggtctcaaaatccactgcccagtgaaaatata
gagtcaaaacctgatgaaaagtcagcaatagaagcatcagaggtaaataagcttgtgatt
atgaggcagcgcagaaggtcctcaaatgttccacaggaatctcgtgaccagagtttagta
gagtcgatgttggaggtctccacaattgatgaatccaggccactttcaaagaagaaaaaa
gataaaaagaaaaagaagaagaaaaatcgcaaagaatctgaaaggaaaccagagcctcat
tcaccatcagcaaaagatcttggcccttcagctgatgatcctcaaaagctcgctttcgac
aatgattttgtcggaattccaggtctaaaactaaccaggatacgaaacccaaaagcccgg
tctcgcaagaaacgctgcaagtttgtgtggactctcactctggtgaaaagcaaaagcaaa
gattcccaaatccaagagaatttaagtaatactcaagaaagcaaaagcaaagattcccaa
gtccaagatgatctcagcaaaacacaagaaatcaaaagccaagattctcaaatccaagag
agtcagagcaaagtagatgaaagccccagtacagaggcagaacttcctcctaaatgtgat
gaggaagtagatgtttctacagaagcagaatccacatccactccttcgaacattttggaa
actggctcttcacaggagtcacaaaacgtagagaacactgtcggtgctgtaattcccgaa
agcacagagaaccccgtggccattgagaaggttgaggagaccccagaaaaggaaagcaag
ggggttcttgaaaggtcagaaattgcaacagaagcacatccagaagaggccactcagacg
gaccctgaagatctgatcagtaaggatgccgttccaccacttcaaatcaaagttgtctcc
tcaccaggtaaaaaaaactgtctaaagcagtccttcttaattcagcaagtcacaacctca
cctgaaagaaaagaaccctcaaaagttgaagaccctcagcattcagagaagagtgagaat
gtgttagaaattactgctgccgctcccaccccaaaagtaaggaaaaggcaacatcaaaac
actgctcggaagaagcgtgcaaaacataaacactggacaatttacaggcgaaaatgtaaa
ttgaatgcatctcaagaaaaccccgcttctgaaactgaaaccgaatctcaggtggaggaa
tcatcagtatcaccaacagcagtcccagcacctgtagaatccaaaccaaataggcattca
agtgaagttatgcataaaataggtaaaaggtcagctccaccaactatagaaccattacct
gaagccgccaaacctcaggtcatcgaacaaactgttgaaccacctccaaccaacccattt
cttgggacagaaccccagccagaaataaaacttgaggcaccatcaattgaaactgaagag
gttctagtattagagccttccgtaaaagatcacccacaggtgcctcgtccttcacgcagg
cgaataaaacgggtcaaacgaagacgaaaatctttgattggccggcggattaaaaactca
aaattgcaaaagaaggagttgtttgaggttagtaatgatttcccaccgataacgagtagt
agaaagtcttcttctgaagtagaagagcctaaactctttggtatattctcaacaaagtac
aagaggaaacgaatatcgaggcttcagtcattagagggtagacggaaaaaggccaagctc
ttatcaaagcaactggataacaccaacggagatcagctttccgatcagacagaaagggat
tctgtcattgtgaaaactgaccgagatcaggacatccaacaaagcaaaacgaagttcatg
aaaactattagacatttcataatgccagtcgtgagcgcccgatcctctcgggttatcaaa
acgccaaagaggttcatggatgatcttggtatgtcaggccttcctcgcaagaactcccaa
aagaagcttggcctacaaccaaaatcaaagaagcgtgattctagtgaaaaaggtgaacct
gaatcctttcagtttaaggatgaagataacgatctgagtgaagctgatcttgatttgtct
tccacttgggaatcaaaacctaaatcacccaatgatgctgagatcttcagtgaggagaag
cagcctgggaaaagacgatcgctactccgagatcccagtttcaaatggggagtgctggag
cctgccagtgacgacgtgtatgccttcaatgaagatcttgacaaggagttggataccttg
ctatctgccaaagcttttacagtggacccgtttcttgatcccatccaaaagaagaaaaag
tccaccaaattcaaagtgcaatcatcaaaattgaggttatacaaaaagcttaaactcaaa
cagagtctggcaaggcgtaaaaagaccccaaaggacaaaatgattcaagttgtatcatcc
cctgctaagacacagaaggaggagttggaagaaggggccagtctaataaagtctctcaaa
gacatgaagaaggaaaaagctaaactcaagattgaggatctcaacacccctggggttgtt
cgcaaagtctccatctgtgtccgagctctgagtgccaagttgctggcgcaacaccaggcg
aaagacatccaagaggatgacctgccagatgagttctccattcatacagacatctcactt
ccaaacaaatgtaaagactttgatgagatgcatcacgcagattcagaagggccggtttct
gagggtactccgaaacatgccgctgacgttgaggagaaaactgccattcagcaccctcgc
cttacaggagtcaacaagcgcatgttcaaccttctcaagaaagccaaggttcagctcatc
aaaatagaccagcagaaacagctgaagtcatctgggctcttgccaatgggtagaatcact
gcaacaaagagaccgagacgaaaaccgaaagagcggcttgaaaatgcctgtgccaacaag
actgaagcttctccagagcaggaacctgccagaggagggcctcgcattaagcatgtatgc
agagctgcagctgtggttttgggtcagcctcgtgccatggtccccgacgacatcccccga
ctcagtgcactacccctgcacgagagatcagatatatccccttcacctgcagaaaaagga
gttgagtctcactctgacccagaaagccctgtattacaagaacacaggacacccaagttt
cgccgtggtagggctcacttgtttggcaaccggtcccgacggtgtggggagtgtaaaggt
tgtctgcatgaggaggactgtggcaggtgcataaactgcttggacaagcccaagtttggc
ggccccaacacaaaacggcagtgctgcatatacaagagatgtgatcaggttgaggaaagg
aaggccttgagactaagtggcaagctccaaaaagggtatgtgaagaagcggcgctcatcg
ataagtgcggggcactcaagtaatgaggaatgtgagggcagtgatgggatcgggcgaatg
tttccagcctctctaggtgacagtccgtctgtgcggaaacagccccgccgacatgtaaag
ccacgttcctactgcgacctgctggattacgactctgactttgactggataggaggatca
aattccacctccccagcccgcagaagaactcctggccttcgcaactcagattttgtgtca
ttcgacgacttcattggcgatgcttttgacgagggagtgcggcatcgcagaccaagcttc
cacaaggttccacccattaaacggaaagttgagaagagccctcaggaccagacaccgccc
agcgtccttgcagccctcgccaatggttttgcagagagagaacaggagcccgcagagccc
acacacaagatccgtgttgattttaaggaggactgtagtgtgcagagcgtgtgggcgaca
ggaggtctgagcatccttacttctgtacccctcgtgccccagtatgtctgcctgctgtgt
gccagtaaaggccagcatgagatgctgtattgtcaggtctgctgtgagcctttccatcac
ttctgcttggacccttcagagcgcccactggaggagaacaaggagaactggtgctgtcgg
cgctgcaagttctgccgagtttgtggatgcaagaataaagaatccaagcctctgctggag
tgtgaaaggtgtcagaattgttatcatcctgcctgtctgggtccaaactaccccaaaccc
aacaaacgtaagaagccttgggtttgtatgacatgcatccggtgcaagagttgtggtgtg
accccaggaaagagctgggacaccgagtggaatcacgacaagggtctgtgtcctgactgc
actaggttgtttgatcaaggtaactactgcaccatgtgcttcaagtgttatgaagataat
gactatgatagccagatgatgcagtgctccacatgtaaccactgggtccatgctaaatgt
gaaggcctcacagatgacttgtatgaaatcttgtcgagtctgcctgagagtgtggtgtac
tcctgtcagccgtgcttacaagagcagcctgatggagaggacgttaatggagcaggatgg
agggaactgctcgaccacgagctgaagactggtttagagagagtgctgtcttgcctgctg
agctccagcctcactaagcacctggtcacctgcaagaagtgcactacagtgggttccctg
aacactgtggatggaaatttgcctgtctgtgacttccgtgctattggaaagaagtttgat
gaaggcctgtacacatccttgaaatcctttcatgaggatgtggtgacagtaattcgcaat
tacttggaagatgaggaatttttaccggaggaccaaagacccactgccctttcccgctcg
tattacctgaagctcttagaggaagtttatgcgtggtttaacagtcaggaccctaaaata
tgggatccacgctccaaacatctgccagccggtatgctttcacatgctgtgatgccacca
aattatgaacatgtttatgctcaatggcgtgagagagatggatgtcataaggctttggac
ggcgccccacagagtactggaagacacatggatgttaaattgggagaagaagaggatgtg
tccacacctttagcccataaccctaaaggatactttatggacacaagggcgttacaaatg
aatctgaaagggaagaagggtcggcctgctaaatccgacctggacacaggtttggacgac
gagagacagtgcgctctgtgtcaaaaatacggtgatgcaaaggccagtgatgcagggagg
ttgctctatctagggcagaatgaatgggctcatgtaaattgcaccatgtggtctgcagag
gtgtttgaggaggacaatggctcacttctgcatgttcacagtgctgttgcacgaggtcgt
ctgatgcgctgtgaacggtgtaaccgaactggggcaacagtaggttgctgccttacttcg
tgccagagcaactaccacttcatgtgcgcccgctttcgcaactgtgtcttccagaatgat
aaaagagttttctgtcacaagcatcgtgaccttataagtggaaaaatcatcactggtcaa
gggtttgaagtacttcggagagtttatgtggattttgaagggattagttttcgcagaaag
tttttgactggattggagccggagtcaatcaatttaatgataggttctttgctagtaaaa
aagcttggaaagctgagtgaattatctgcctgtcatggaaaacttttccccgtgggttat
gaatgctctcgctggtattggagtactgtaaaccccttacgtcgatgcaaatacacattt
cgtgttagggaggttcggccaactgttcaggaaaaaccagtggaagagtcgcccgatcat
ggagaaaattgcacaattgcccatagcccatggccccagtcagaatctgaagccccggga
gtggatttgtcttcaactaatccttccactgaaacaaattccacctctgtatctgtcttt
gccaaaccggacattggtgctcgtcccaaaatccctttatacccccagaacagaagacct
gctggaggactatccagaccactgccttctccaggagctgccccatccaaacctcaccac
atcctgactattagtgatttggatgacactcgaaggccacgacggcatagcccacacacc
cagaatattggtacccgcagtcacatgacctcccctactcttggatcccctgcagcccca
attgcatctagagcaggtggttcccaccaccctaaaacctcccagcctacctccccagtt
ttcccccttggtgctactgaaaacctgctgacctcttcatcagctcgtcctgtcggtcga
agtgcttcctcagtccggggttctggaatattgacaccccattctacctcaggactattt
tcacagtccacaaggcaaggtggcattagcagcaccccttgcaccaaccaatcactcaca
tctcccacccacctctccacaagaccaatgccttttgattttaatcagatagactctgtt
gaacttccacataattttatagcatcaccacgggagcatccagcagaaaatggtgccttg
ccattattaggagacactttgggtacacaaaaaggtaatcatctaggcagagacagggat
ttcccttacacatccttccacttagaggcggacctgactgtggcacctgagctgagaact
gagcttgaaattgaagaaaccgagctgaatgaaggcgtagctatgaactgcagtgcgcaa
attgtagttgaaggtgaagacaaccaggaagacttctgggaaccagatgaagagaagtcc
aaaatgtctacccagagattgtcttgtactgttgatccttgtagggaagactggggtaat
agttcttcggatgaggacatggaaaactacatcaacttcactcgcacggtggttacttgc
aaggctcaaagggatgcatctcagtcatctacatctccatctccatctttaaggcagatt
tcacaacttgatggtgtggatgatgggacagagagtgatacaagtgtggctaataatgaa
aaccagggtgtgaaattgtcaaatcaagcccaaaagccacacaaaccattcaacgctgtg
cctcatgaacagacagctagcaacggtctgtgtttggcatttccaagtcctgtttctgat
ttttctttaattcaattagaacccgtgtccaactcggagactgttgctgatcaagattat
tttggtgtaacgcaaacattgcaatcaagccaagaccctttgacaaatttcgttgatcaa
aagccttcaaacactgcattttctacatatggtaatgattaccaaacccctcatttaatg
gttgaaccagagacacccttaatttttgagagatgtgatcctctttcaccaaatgcccat
ttcacagagttggtcccagtccaggattccctgagtgacccaccggactctaaagaattg
tacttggatcctagtagtggccattttgtgtcatctatggctgactctagagtttaccaa
aacaaccacttgcaagatgattctcctgacctaatggaagttaatggaattcagaatcta
cagcaacaaaatcctgttcctttcacagtgttacctaaatctgcatcattttctgaactt
ttatcttctgattcctctgcacatgtttcttttgcaacattcccaaatcaggcaccatct
gcaaatgtttccttgtaccctgtccaaactcctgagggtaagacagtcttgccacccatg
gagagtttcagaaccaaattacacccacctgctgaaccaagccatggaggggcaatgcca
tgtattcccacaaatttaccacagaaaccagagtcaatgctgtctgtgccatcagcaact
ggtgtacctcttgggacttatgggccagtttcgggtacagtgtctgtcccattgcatccc
acttacccacagcccatcggctctacaactgttggcatgatctcctcctctgtaacttct
caaccatcagctcagtgccaagcaatgccttctgctattcagccagtctctgctccaggt
gtcatcaatgggtacaacaccacacctatgcaaagagaaacagctctaggacgaacaatt
tccatcaatttttcaacccccagatcaacaattgaaccccaacaacagttggttacccaa
gcattaccaggtcatgctattcttaccgtaaaggaggttggtggacccaatgtggatcct
acaccacatgttttacttgttaatcgtcttggtcagatttttgtcaaaaaccctgagagc
aacaccttccagctaccgacaccaaattccccttcatataactgtgttactcaaatcgcc
agcctcttgcaaagcaatgccttatcggcaacacttgcagcagctgggaacttgacccca
gttgcaggtgccaccattccaacccaagtcccccaaattgtgaccccactggtacagacc
tccaacaccattacacagctacttaccactagtactaatggagcagcttcaataccagca
gatgtgaaaaagccacgtaggaatgccaaagcttctggagatagattgaaaaaaccaagg
aataaggagtcttctacacctagaaggacgaagtctgctagcacacatggcccttctagc
aaacaatctacgagccaaatagtaacatcctcagatatatctaatcaagcagattgtgcc
caagctatcatcaaccaagctatggctggatattatgatcccaacaagactgtttcccta
attccctcatcacctcgtaacactaccattattgggcaaactcagacaacaagttcagtt
ttaccagaaggactccttgtcgaaccagagatgaaggcttccccaccagcgacaccagaa
gcagcacctcgaccaaaacaggttcgaatgaaaagagtgtcctctttatctgaccgtttt
accaccaagaaatcaaaatctgactttttagacctggaccgccctagtggattggaagaa
ccacgcaagtcaaactccgtatcagccaggtatggagttcgcattaaaaccccaaccatc
aagggaattctagactgtgacaagctgaatgaagagcgaagtagtgactctgagagtgca
aggcctggaccttgggatcgtctttcgttgcctcgtggtggagacagcaacaagccagca
acctgggatcctactaaccgtaatgcactgtctgactggaacaaatactcggggatgctg
tcctgttcagatgatgagatgcctccctcagatggtgaagagcatagtcctcccagccga
gaccagccccacctacgctttgagatcgctagtgatgacggcttcagtgtagaagcagac
agtatcgaggttgcttggtccgctgttatcgagggagtccaggaggcccgtgctgtcgct
ggcctgaggcagcttactttttctgggatgagcggggcacgtgtgatgggaatgctgtac
gatgccatagtctacctggtggaacagctccagggggccaatcgctgccagcgccacacc
ttccgcttccacaagcaagccagtcaggaggaagatctgcccgttaacccaagtggctgt
gcccgctctgaagtctacctaaggaagtctacctttgatatgttcaacttcctggcgtca
cagcatagacagcttcctgacaccgacctgtatgatgaggaggaggatgaggttcttctc
aaatccaccaggcgtgcaacaagtttggagcttccgatggccatgcgctttagacatcta
gagaagacatccaaggaagcggttggtgtctacaggtctgcgattcatggaagaggtctg
ttctgcaagcgaaacatcgaggcaggagagatggtcattgagtattcaggcattgtcatt
cgttctgttcttacagacaagagagagaagtattatgatggcaagggcattggttgctat
atgttccgcatcgacgactttgacgtggtagacgccacgatgcacggtaacgcggcgcgg
ttcatcaaccactcctgtgagccaaactgctactctcgagtcatcaacgtggagggtcag
aagcacatagtcattttcgctttgcggaaaatctaccgtggagaggagctgacctatgat
tacaagttccccatagaagatgccagcaacaagctcggctgcaactgtggtgctaagcgc
tgtcggcgcttcttaaactga

DBGET integrated database retrieval system