KEGG   Sinocyclocheilus grahami: 107585219Help
Entry
107585219         CDS       T04918                                 

Definition
(RefSeq) histone-lysine N-methyltransferase NSD2-like isoform X1
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107585219
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107585219
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107585219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 107585219
NCBI-ProteinID: XP_016127611
LinkDB All DBs
Position
Unknown
AA seq 1471 aa AA seqDB search
MTDSKGTSLPAMPEPGSPTTMKQPSDSPGGRKGRGDGSTDPTMLMDKAATQLAATPQESV
LQMIGSHGHNHTHERLKDLTSRLLNGDQDTIPKLCTATAAQPLLKGVEPVPQHASPPRKS
SVSPELTFKITKCVVNLGGKTNRFGADYAGEGTEETDAPLRLSEGFLASPTARRERRKKK
RGLVRKRSPPNRTQSILTPTLSSDKSPLLHTTIRSNDLTIEPCVPTASNEQTDGEIPVSV
PSIPIQEPVSDCELSDVAQGVDDVEVCCTGTQPHLQFSVGDVIWTKVSGYPWWPCMITTD
PEFNMHFRSKVNSRTGLLYHVQYFGNAPERGYVFEKSMVTFSGKHQYQSLCRSNKLPIDI
SGRKMSLMCSLQRAVPRKFREQWETGVSQATEALGLLLEERLAKFSFVYENGKAQFNPRM
LQELQAQRNQGPQQDPDQRESQELVSLTPPDSTHSSPNSTTTTIIPGLFSQPTDSSTSSG
KNTFPQKAPKTSAKKDRHGTILKWKKTEASSAKDVPGSNVQVSCTASETSEHQSKIKTKA
GKWAYQQKKDLLCIDLDLQPKAQKKQRQLRQKFPAAPNSVKKRKVKAGVSISDTLSAVST
NPGLSDIKVLAPSPKVLEEEDSSKGKKIVYKRLRESKDDVVLQPKKKTKLEKVVKKQKGQ
KKAPSNEATVSKLRGRRRKADRDDKRKRAKGPRGESPAKAKRVRKWKQESGRQSFPVSSK
KHCPLSSPEPESSLCEQRPDSPSDSTDESHHSKKIERTAGARKESVCLVCEQTGEDLVMC
EGQCCGSYHLHCIGLDRSAEKVLCTACSSGVHVCFTCKKSEGEVRRCCVLHCGRFYHEAC
VRLSALTVFENRGFRCPLHTCLSCHYSGRGVGKATKGKMMRCLRCPMAYHVGDLCVAAGS
EMITSSAIVCTNHFRPKKGYSHHSHVNVSWCFICSKGGRLLCCESCPAAFHPDCLNIAMP
DGSWFCNDCRSGKKPKYRDIIWVKLGNYRWWPAEIRHPKNIPTNIQHLRHEIGEFPVFFF
GSKDYFWTHQGRVFPYMEGDRGSKYQHNGIGKVFKNALLEAEARFKEIEMEREAKEAQEN
NKKPPPYKYIKVNKPCGRVQVYTADISEIPKCNCKPSDERPCSFESECLNRMLLYECHPQ
VCPAGERCQNQDFTKRLYPETKIIRTAGKGWGLVSLRDIKKGEFVNEYVGELIDEEECRA
RIKYAQENNITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETQKWTVNGDTRVGLF
AVCDIPSGTELTFNYNLDCLGNEKTVCRCGAPNCSGFLGDRPKNGPTSEPKAKHQKKKPK
RRKSRNEGKKSEDECFRCGDGGELVLCDKKGCTKAYHLSCLDRTKRPFGRWDCPWHHCDV
CGKNADAFCQLCPNSFCKAHQEGALQLHLLTGQLCCQEHEDSDIHPQVETPVEHNAEVPS
STKPHKYRRRATATTSSKEPLKKRSRKTADV
NT seq 4416 nt NT seq  +upstreamnt  +downstreamnt
atgacagatagtaaagggacatcattgcctgcaatgccagagcccgggagtcctaccacc
atgaaacagccctctgattcacctggtggacgtaagggtcggggtgatgggagcactgac
cctactatgctcatggataaagctgctactcagttggcagctacacctcaagaaagcgtt
ttgcagatgattggcagtcatggtcataaccacacccatgagcgactaaaggacctgact
tcccgcttgttaaatggcgatcaagacacaattccaaagctctgtaccgccacagctgca
cagcctcttctcaaaggggtggagcctgttcctcaacatgccagccctccgaggaagtcc
agtgtttctcctgaactcacttttaaaataaccaaatgtgtggtaaatctaggtggtaag
acaaatcgattcggagcagattatgcaggggagggaacagaggagacagatgcacctttg
agactttcagaaggttttctggcctctccaactgccaggagagaaagacgaaagaagaag
aggggtcttgtgaggaagagaagtccaccaaatcggacacagtcaattttaacccctact
ttgagttctgataaatcccctctactacacaccaccataaggtctaatgacctcaccatt
gaaccatgtgttcccactgcatctaatgagcagactgatggcgagatacctgttagtgta
ccttccatccccattcaggagcccgtgtctgattgcgaattgagtgatgttgcacagggt
gtggatgatgtggaagtgtgttgtacagggacacaaccccatttgcagttctcagtggga
gatgttatctggaccaaagtgtctggatacccttggtggccatgcatgatcactacagac
ccagagtttaacatgcactttaggtcaaaagtgaatagccgcacaggattattgtaccat
gtacagtacttcggaaatgctccagagagaggatatgtttttgagaagagcatggtcacc
ttctcaggaaaacaccagtaccagtcactttgccgcagcaacaaactacccattgatatc
agtggaaggaagatgtctttgatgtgctctctacagcgggcagttcctcgtaagttccgg
gaacagtgggagacaggtgtgtcacaggcaacagaagccttgggtctactattagaggag
cgactggccaaattcagctttgtttatgaaaatgggaaagcccagttcaaccctcgcatg
ctacaagagcttcaagcacagcgcaatcagggaccacagcaagacccagatcagagggag
tctcaggagctggtcagcctcactcctcccgactccactcattccagccccaactccaca
acaacaaccatcatcccaggcctcttctcccaacccacagacagtagcacttcatcaggg
aaaaacaccttcccccaaaaagcacctaaaacgtcagcgaagaaggatcggcacggcaca
atactgaagtggaagaagacagaagcttcctctgcaaaagatgtccctgggtctaatgtt
caggtttcctgcactgcatcagagacatctgaacatcagagtaaaataaagacaaaggct
ggaaaatgggcttaccagcaaaagaaggacctgctctgtattgatctagaccttcagcca
aaagctcaaaagaaacagagacagctcagacagaagtttcctgcagcaccaaattcagta
aagaagaggaaagtaaaagctggtgtcagtatctctgacactttaagcgcagtgtccact
aatcctggactttcagatataaaggtattagcaccaagcccaaaagtcttggaggaggaa
gattcatctaaaggaaagaaaatagtctacaaacgtttacgagaatcaaaggatgatgtg
gtgctgcagcctaaaaagaaaaccaagcttgaaaaagtggtaaaaaagcagaaaggccaa
aagaaggcaccatcaaatgaggccactgtcagtaaactcagggggaggaggcggaaggca
gacagggatgacaaaaggaaacgagctaaaggcccaaggggcgagtctcctgctaaagcc
aaacgtgtcaggaagtggaaacaggagtcaggcagacaatcttttcctgtctcatccaaa
aagcactgcccattatcttctcctgaaccagagagttcgctgtgtgagcagagacctgat
tctcccagtgacagtacagacgaatcacatcactcaaagaagatcgaacgaactgcaggt
gccaggaaagaaagtgtgtgtctggtgtgtgagcagactggggaggatctggtgatgtgt
gaaggacagtgctgtggctcatatcacttgcactgtattggactggatcggtcagcagaa
aaggtgctctgcaccgcctgcagctcaggtgtgcatgtgtgtttcacctgtaagaagtct
gaaggagaggtacggcgttgctgtgtgcttcactgtggccgcttctaccatgaggcctgt
gtacgtttgagcgctctgaccgtgtttgagaaccgaggcttccgctgccccctgcacacc
tgcctcagctgccactacagcggccgcggcgttggcaaggccaccaaaggaaagatgatg
cgttgtttacgctgtcccatggcctatcatgttggagacctgtgtgttgctgcagggagt
gagatgatcacttcctctgccattgtgtgcacaaaccacttcaggcctaagaaaggctac
agtcaccactctcacgtcaacgtcagctggtgctttatctgctcaaagggtggccgtctg
ctgtgctgtgagtcatgtccagctgcgtttcaccctgactgtctgaacatcgctatgcct
gatggcagctggttctgtaatgactgccgctcagggaagaaacccaaatacagagacatc
atctgggtcaaactggggaactacagatggtggcctgcagagatacgtcaccctaagaac
atcccgaccaacatccagcacctccgtcatgagatcggagagttccctgtgtttttcttt
ggctctaaagactatttctggacacaccagggcagagtctttccttacatggagggagac
agggggagcaaataccagcataatggcattggaaaggtctttaaaaatgccctactggag
gctgaagctcgctttaaggagatcgagatggagagggaggccaaagaggctcaagagaac
aataagaaacctcctccatacaaatacatcaaggtgaataagccttgtgggcgagtgcag
gtgtacaccgcagacatctctgagatccccaagtgtaactgtaagccatcagacgagcgc
ccctgcagcttcgagtctgagtgtctgaaccgtatgctgttgtacgagtgccatcctcaa
gtgtgtccagctggagaacgctgccaaaaccaggacttcaccaaacgcctctaccccgag
accaagatcatccgcacggcaggcaaaggctggggcctggtgtcattgagagacattaag
aaaggagagtttgtgaatgaatatgtgggtgaactgatagacgaggaggagtgcagagcc
agaatcaaatatgctcaggagaataacatcacacatttctatatgctcactattgacaag
gatcgtattatagatgcgggacctaaagggaactactctcgcttcatgaaccacagctgc
cagcccaactgtgagactcagaaatggacggttaatggagacacacgcgtgggcctgttt
gctgtctgtgacatcccttctggcactgagctgacttttaactataacctggactgtctt
gggaatgaaaagactgtgtgccgctgtggagcgcccaactgcagtggtttcctaggtgac
agacccaagaatggtccaacttctgagcccaaagccaagcatcagaagaaaaagcccaag
cggagaaagtcccggaatgaaggcaagaagtctgaggatgagtgtttccgctgcggtgac
ggaggagagctggttctgtgtgataagaagggctgcaccaaagcctatcacctttcctgc
ttggaccgcaccaagagaccatttggtcgctgggactgtccctggcatcactgtgacgtg
tgcggaaagaacgccgatgctttctgccagctgtgccctaactctttttgcaaggctcac
caggagggggcgctgcagttgcacctgctcacgggccagctctgctgccaggaacatgaa
gactctgatatccaccctcaggtggagaccccggtggagcacaacgctgaagtaccctca
tccaccaaaccacacaagtacaggcgcagagcaacggccacaaccagcagcaaagaacct
ctcaagaagaggtccagaaagaccgcagatgtgtag

DBGET integrated database retrieval system