KEGG   Sinocyclocheilus grahami: 107587657Help
Entry
107587657         CDS       T04918                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00590  Arachidonic acid metabolism
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    107587657
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107587657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 107587657
NCBI-ProteinID: XP_016130999
LinkDB All DBs
Position
Unknown
AA seq 597 aa AA seqDB search
MKVFSFLLKWTFILLLSLSLCDGEESPTSSNVVNPCCYYPCQNRGICVRYGLDRYECDCT
RTGFYGENCTIPEFWSRVSQLLKPSPNVVHYVLTNFDWLWDIINRTFLRDWLMHKVLTVR
ANLIPSPPTYNSKYDYLNWEAYSNITYYTRILPPVPRDCPKPLGAKGKMKLPDPKLLVEK
FMLRRNFRPDPQGTNLMFAFFAQHFTHQFFKTHNRVGLGFTKGLAHGVDAGHIYGDSLDR
QLDLRLHKDGKLKYQVVNDEIYPPTVLDAPVKMNYPPSVPPEQQLAIGQEVFGLLPGLSL
YATLWLREHNRVCDILKQEHPTWGDEQLFQTTRLIIIGETIHIVIEDYVQHLSGYRLKLH
FDPALLFTSPFQYQNRIAVEFNQLYHWHPLMPDSFHIAGEEIHYPQFLFNTSILTHYGVE
KLVDAFSTQPAGQIGGGHNIHQVVCKVAEGVIIESRELRLQPFNEYRKRFNLKPYTSFSE
FTGEKEMAKELEKLYGHIDALEFYPALLLEKTRPGVIFGESMVEMGAPFSLKGLMGNPIC
SPEYWKPSTFGGKTGFDIVNSATLKKLVCLNTKWCPYVSFHTPPADYKQQRTSHGEL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtttagctttttactgaagtggacttttatcctgctgctgagtctctccttg
tgtgacggggaagaaagtccaacttcttcaaacgttgtgaatccttgttgctattaccct
tgtcaaaaccgagggatttgtgttcgatatggcctggacagatatgaatgtgactgcacc
agaacaggcttctatggagaaaattgcactatacctgagttctggtctcgagtctctcag
ctcttgaagcccagtcctaatgttgtccactacgtcctcaccaactttgactggctatgg
gacatcatcaacaggaccttcctcagggactggctcatgcacaaagtgttaacagtaaga
gccaacttaatcccaagtcccccaacatacaattccaaatatgactacttgaactgggaa
gcatattccaacatcacctactacacaagaattcttccaccagtccctcgggactgcccc
aagccattgggagccaagggaaaaatgaagcttccagaccccaagcttctggtagagaag
ttcatgttaaggcggaatttcagaccagaccctcagggaacaaatttgatgttcgccttt
ttcgctcagcacttcacgcaccagtttttcaagactcacaaccgtgttggacttgggttc
acaaaaggtctggctcatggggtggatgctgggcatatttatggagattctcttgatcgc
cagctagacctcagactgcataaagacgggaagttgaagtaccaggtggtcaatgatgag
atatacccccccacagtgctagatgcaccggtcaaaatgaactacccaccatctgtcccg
ccagagcagcagctggccattgggcaagaagtgtttggactgctgccgggtctcagtttg
tacgccaccttgtggctgcgtgagcacaaccgtgtgtgtgatatcctgaaacaagaacat
ccaacctggggggatgagcagctgtttcagaccaccaggctcattattataggtgagacc
attcatattgtgatcgaggactatgtgcaacatctgagcggttaccggctgaaactccac
tttgatcccgcgctgctgttcacctcaccgttccagtaccagaaccgtattgctgtggag
ttcaatcagctttaccactggcacccgctcatgcctgacagcttccacatcgctggagaa
gagattcactaccctcagttcctgttcaacacctctatcctcacccactacggggtggag
aagctggtggatgccttctcaacccaacccgcaggacagattggaggtggtcataatatt
caccaagtggtgtgcaaagtagctgagggggtcatcattgaatctagggagctccgactt
cagccctttaatgaatatcgcaagagattcaatctgaaaccctacacatctttctcagaa
ttcacaggagaaaaagagatggctaaagaactagagaaactgtatggtcatattgatgct
ctggagttctacccagctcttttgctagagaagacacgacctggtgtgatatttggcgaa
agcatggtggaaatgggggccccattttccctaaaaggcctcatgggaaatcctatttgc
tcccctgagtactggaagcccagtacatttggggggaagacaggttttgatatagtaaac
tctgctactttgaagaaactagtttgcctcaatacaaaatggtgtccttatgtatctttc
catactcctccagcagattacaaacaacagaggacatctcacggtgaactttag

DBGET integrated database retrieval system