KEGG   Sinocyclocheilus grahami: 107593090Help
Entry
107593090         CDS       T04918                                 

Definition
(RefSeq) transmembrane protease serine 9-like
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
sgh  Sinocyclocheilus grahami
Brite
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     107593090
Peptidases [BR:sgh01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107593090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 SEA Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 107593090
NCBI-ProteinID: XP_016138159
LinkDB All DBs
Position
Unknown
AA seq 730 aa AA seqDB search
MEKKDLNKWPEGDPRPAYLSTCKCMTLAAILILLIIGAAVGFMTAYLIQEEHYFMETVEL
QGLSYDPDLRDKTSGFYVVLTATLKEKIRNIFSSSAVASHFTDCQIVAYGNANTNVLTTL
HLVFRISQVQGFTESFVQDLLRTGLKVPIVVPDYGEISSIILLACGTRPAMANRVVGGEN
ARHGELPWQVSLRLRGHHTCGASIVNNRWLVSAAHCFEIENDPKDWTALVGANLVSGEED
KATTVNIKSLVLSPSYDPMTTDSDVTVLELETPLTFSPYVQPVCIPSSSHIFSAGQNCIV
SGWGALNQYSSEYPSTLQKAIVKIIDSRVCNKSSVYRGELTQNMMCAGFLQGKVDSCKGD
SGGPLVCEVSPGRFFLAGVVSWGVGCAQINKPGVYSRVTKLRNWILSYTNTAPTIQVGPT
VPSVKTTALHISKSINPSTEHVNNDYNPTPGNCSANYNCGGDMCISKTNPECDRVSDCPN
DADEKNCDCGNRPVIGQERIIGGVTAHRGEWPWVGSLQYQRTHRCGATLIHCKWLLTAAH
CFRVDLNPSSWTVSLGSVIWSGVGALVIPVQRIIPHPAFNRSTMDFDVALVEISIPTPKS
YTIQTVCLPSPWHIFNKNMECYIAGWGAVREGGMITSLLQKAQVSIIDQLDCQQAYGAEL
TNMMCAGSMEGDRDTCLGDSGGPLVCHEPQGRWFLAGVTSWGHGCGRLGFPGVYMQVTAV
REWISTYLPL
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaagacttgaataagtggcccgagggtgatccacggccagcttacctctcc
acttgcaaatgtatgactttagctgccatattgattcttctcatcattggggctgctgtg
ggttttatgacagcttacttaatacaagaggaacattatttcatggagacagtggaattg
caagggctcagttatgatccagatctgcgtgataaaacatcaggattctatgtagttctg
actgcaactctgaaagaaaagatcaggaatatctttagcagctctgcagtagcaagtcac
tttactgactgccagatagttgcatatgggaatgccaacacaaatgttttgacaactcta
catttggtcttccggatctctcaagtccaggggtttacagagagttttgttcaagacctc
ctccgcactggattgaaggtgcccatcgttgtcccagattatggagaaatcagtagcatc
atccttcttgcctgtggaacacgtccagccatggctaaccgtgttgtgggtggtgaaaac
gcccgtcatggggagcttccctggcaggtcagtctcagactgcgtggccaccatacctgt
ggcgcatccatcgtcaacaatcgctggctcgtcagtgctgcccattgttttgaaatagaa
aacgatccaaaagattggacagctcttgtgggagccaatctagtcagtggagaggaggac
aaagccaccacagtaaacatcaagtccctggttctctctccaagctacgatcccatgact
actgacagtgatgtgaccgtgctggagttggaaacgcccttgacgttcagcccttatgtt
cagccagtctgtatcccatcatcctctcatattttcagtgctgggcagaactgcatcgtc
tctggctggggggctcttaatcagtacagcagtgagtatccttctacattacagaaggca
attgtgaagatcattgactcgagagtttgcaacaagtcatctgtatacagaggtgaactt
acccaaaatatgatgtgtgctggttttcttcaagggaaggtggactcttgtaagggagat
tctggaggccccctggtatgtgaggtgtcccctggacgctttttcttggctggcgtggtg
agctggggagtgggttgtgcacagatcaacaagcctggggtctattcccgcgtcactaag
ctccgcaactggattctgagctacaccaatactgcaccaacaatccaagttggccccaca
gtccctagcgtcaaaaccactgcacttcacatcagtaaatctataaacccatccactgag
catgtcaataatgattataaccctactcctgggaactgcagtgctaattacaactgtggc
ggagacatgtgcatcagcaagacaaacccagagtgtgacagagtcagtgactgccccaat
gatgcagatgagaaaaactgtgactgtgggaatcggccagtcatcggccaggagaggatt
attggtggcgtcaccgctcatagaggtgaatggccgtgggtgggcagtctgcagtaccaa
cgcactcaccgctgtggagctacacttatccactgcaaatggctcctgactgcagctcat
tgcttcagagttgacctgaacccatccagctggacggtaagtctcggctcagtcatttgg
tctggagtgggtgctctggtgattccagtgcaaaggatcatccctcatcctgctttcaac
agaagcaccatggacttcgatgtggccctggttgaaatctccatccccactccaaagtcc
tacaccatccagactgtgtgtttgccttctccctggcatatcttcaacaaaaatatggaa
tgctacatcgctggatggggtgctgtgagggagggtggtatgataaccagtttgctgcaa
aaagcacaggttagtatcattgatcagttggactgccagcaagcttacggggctgaactt
accaacatgatgtgtgctggctcaatggaaggagacagggacacatgtttgggagactca
gggggccctctggtgtgccatgaaccccagggccggtggtttctggctggggtgaccagc
tggggtcacggttgtggtcgacttggcttcccgggagtttacatgcaagtcacggctgtc
agagaatggatatctacatacctccctttataa

DBGET integrated database retrieval system