KEGG   Sinocyclocheilus grahami: 107596936Help
Entry
107596936         CDS       T04918                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107596936
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107596936
Chromosome [BR:sgh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107596936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 107596936
NCBI-ProteinID: XP_016143284
LinkDB All DBs
Position
Unknown
AA seq 809 aa AA seqDB search
MGESKNMVLNGRRHGSKFSSNQPVSKSRLQNTQRPHLRQSKGSPSARRCSRRCGGAPPEA
ERRHVPSSGMTAKELCEYDDLSTSLILDPYLDFQTHKMNTRFRPIKGRQGELREVIELFK
KHDNLEKAFQALTAGDWTRHHFLNKTKSQEKLFKAHVFVYLRMFASDSGFEILPCNRYSS
EQNGAKIVATKDWKRNDKIEHLVGCIAELSPSEERMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGENNEFCECYTCE
RRGTGAFKSKAGLPVETPVINSKYGLRETDKRLNRLKKLGESCRNSDSQSVSSNAEADSQ
EPTTVQTSLRKRTSQSCVKKHDAKTITRQTLSSTPSSTSSSKRSQTNISSLPKRLKSKPT
HPLPKGRRRCRGVWTKSSSRVSASGNLKEPSRRDADRRSSGGKGSVARPSENNQSSSKGA
SPCKDSILCPYRTRRSTRTSLGAQGADGTQASSQPSSPGVVLKSEPEELIPVTPGHQMNT
PSLETSCPKKGTCPRRRRTIKQEDSGSYGESFLQEGVPDLRHAVRAADVADCGKVVLGLP
DRHQHYNGSAKSSKALRRGKGKKKRQITRYDAQLILQNNSGIPKITLRRRRDSSSSKNEA
REANSSSSSKISIKFSKEHEKDRSSSYVAKLNNGFSHGPHSSSTKLKIQLKREEDGAGLH
RTYPEDVTLGIVKREAGDVLDHKAGAQVDQSMEVESLSSEDEEEDYFDNEDDFIPLPPAK
RLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatccaagaacatggtgctgaatggcaggagacatggcagcaagttctccagt
aatcagcccgtaagcaagtccaggctgcaaaacacacagagaccccatcttcgtcaaagc
aagggctccccaagtgctagaagatgcagtcgacgttgtggtggggcgcccccggaggca
gaaaggcgccatgtcccctcatcgggaatgactgccaaggagctgtgtgagtatgatgat
ctgagcaccagtttgatcctggatccttaccttgacttccagacccacaagatgaacacc
aggtttcgaccaattaaaggtcggcaaggggagctgagggaagtgatcgagctttttaag
aagcatgacaacctggaaaaagcttttcaggctttgactgctggcgactggacaagacat
cactttctcaacaagaccaagtcccaagaaaagctgttcaaagcgcatgtgtttgtttac
ctacgcatgtttgcttcagacagcggctttgagatccttccttgcaatcgctactcctct
gagcaaaacggagccaaaattgtagcaacaaaagattggaagaggaatgataaaattgaa
catcttgtgggctgcattgctgagctgtctcccagtgaagagaggatgttgcttcgacat
ggagagaatgattttagtgtcatgtactctacacgcaaaaactgcgcgcaactctggctt
ggacctgcggcttttattaaccatgattgccggccaaattgcaagtttgtgtcaacaggc
cgagacactgcctgtgtgaaggttttgcgggacattgaaccaggggaggagatctcctgt
tactatggagatggattctttggagaaaacaatgaattctgtgaatgctatacgtgtgaa
agacgcggaactggagctttcaagtcgaaagcagggttgcctgtggagactccggtgatc
aatagcaagtatggccttcgagagacagacaagcgtctgaacagactgaagaagctgggg
gaaagttgcaggaactctgacagccagtctgtcagctccaatgcagaggcagactctcag
gaaccaaccactgtacaaacatcattacgtaagaggacttcacagtcctgtgtcaaaaag
cacgatgctaaaactataacaaggcaaactctgtcaagcactccttcttctacctcatcc
tctaaacgaagtcaaacgaatatttcaagtttaccaaagagacttaagtcaaaacccaca
cacccgctgcctaaaggaagacgacggtgtcgaggcgtctggacgaaatcttctagccga
gtgagtgctagtggtaatctcaaggagccctccagacgagacgcagacagacgcagctcc
ggaggcaaaggcagtgtagcgcgcccatcagaaaacaatcagagctcttcgaagggtgct
tccccatgcaaggacagcatactttgcccttacagaactcgtaggtccacgaggacctct
ctcggtgctcagggggctgacggcacgcaggcatctagtcagccatctagcccaggtgta
gtcctcaagtcggagcctgaagagctcatccccgtgacaccagggcaccagatgaacacc
cctagtttggagaccagctgtccaaagaaagggacttgtcccagacgcaggaggacgata
aaacaggaagattccggctcctacggcgagtccttcctccaggagggcgtgcccgacctg
cggcacgcggttcgggctgcagatgtagcagattgtgggaaggtggtactcggcctgccg
gaccgccaccagcactacaacggctcggctaaaagcagcaaggccctgcgccgaggcaag
ggcaagaagaagcggcagatcacgcgctacgacgctcagctgattctgcagaacaactca
ggcattcccaagataacactacgccggcgtcgagacagtagcagcagtaagaacgaagcc
agagaggccaattcctccagctcctccaaaatcagcatcaagttcagcaaagagcacgag
aaggaccggagcagctcgtacgtggccaagctgaacaacggcttcagccacggcccccac
agtagctccaccaagctcaagatccagctgaagcgggaggaagacggcgcggggttgcat
cgcacttacccggaggacgtcaccttaggcatcgtgaagcgagaagcgggggatgttctg
gatcacaaggcgggcgctcaggtagatcagagcatggaagtggaatcgctgtcctctgag
gacgaagaagaggactactttgataacgaggatgatttcatcccgctcccaccagcaaaa
cggctgcgtctcatcgtgggcaaagattccatagacattgacatttcctccagacgacga
gaagatcagtccctcagactcaatgcataa

DBGET integrated database retrieval system