KEGG   Sphingopyxis granuli: SGRAN_1486Help
Entry
SGRAN_1486        CDS       T04372                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sgi  Sphingopyxis granuli
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sgi00001]
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SGRAN_1486 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SGRAN_1486 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SGRAN_1486 (ddl)
Enzymes [BR:sgi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SGRAN_1486 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sgi01011]
 Precursor biosynthesis
  Amino acid ligase
   SGRAN_1486 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1618539..1619462
Genome map
AA seq 307 aa AA seqDB search
MTRGPWHVAVLMGGWSAEREVSLMSGKGIADALESRGHRVTRIDMGRDVAQRLAEANPDV
VFNALHGVPGEDGTVQGMLDLMGLKYTHSGLVTSVIAIDKELTKQALVPHGVPMPAGTMV
DSESLFSIDPLPRPYVLKPVNEGSSVGVAIVRDDSNYGNPIARDAVGPWQAFDRLLAEPF
IKGRELTVAVLRDEPLGVTELRVKSGFYDYDAKYTDGLTQHVCPADVPEEVAQRMKDLAL
QAHRILGCKGASRSDFRWDDEHGLAGIYLLEVNTQPGMTPLSLVPEQARAIGIDYAELVE
RIVEDAL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcggcccctggcatgtcgccgtgctgatgggcggctggtccgccgagcgcgag
gtgtcgctgatgagcggcaagggcatcgccgacgcgctcgaatcgcgcgggcaccgcgtg
acgcgcatcgacatgggccgcgacgtcgcgcagcggctggcagaggcgaatcccgacgtc
gtgttcaacgcgctccacggcgtgccgggcgaggacgggacggtgcagggcatgctcgac
ctgatgggcctgaaatacacccacagcggcctcgtcacctcggtgatcgcgatcgacaag
gaattgacgaaacaggcgctggtgccgcatggcgttccgatgccggcggggaccatggtc
gacagcgaaagcctcttttccatcgacccgctgccgcgcccctatgtgctgaagccggtc
aacgaaggctcgtcggtcggggtcgccatcgtcagggacgacagcaattacggcaacccg
atcgcgcgcgacgccgtggggccgtggcaggcgttcgaccggctgctggccgaacccttc
atcaaggggcgcgaactgaccgtcgcggtgctgcgcgacgaaccgctcggcgtcaccgaa
ttgcgcgtgaaatcgggcttctacgattatgacgccaaatataccgacggcctgacccag
catgtctgccccgccgacgtgcccgaagaggtggcgcagcggatgaaggacctggcgctc
caggcgcaccgcatcctcggctgcaagggggcgtcgcgctcggatttccgctgggacgac
gaacatggcctggcgggcatctatctgctcgaggtcaacacccagcccggcatgacgccg
ctcagcctcgtgcccgaacaggcgcgcgcgatcggcatcgactacgccgaactggtcgaa
cgcatcgtggaggacgccctgtga

DBGET integrated database retrieval system