KEGG   Streptomyces griseus: SGR_5794Help
Entry
SGR_5794          CDS       T00691                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sgr  Streptomyces griseus
Pathway
sgr00010  Glycolysis / Gluconeogenesis
sgr00053  Ascorbate and aldarate metabolism
sgr00071  Fatty acid degradation
sgr00280  Valine, leucine and isoleucine degradation
sgr00310  Lysine degradation
sgr00330  Arginine and proline metabolism
sgr00340  Histidine metabolism
sgr00380  Tryptophan metabolism
sgr00410  beta-Alanine metabolism
sgr00561  Glycerolipid metabolism
sgr00620  Pyruvate metabolism
sgr00625  Chloroalkane and chloroalkene degradation
sgr00903  Limonene and pinene degradation
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_5794
   00053 Ascorbate and aldarate metabolism
    SGR_5794
   00620 Pyruvate metabolism
    SGR_5794
  Lipid metabolism
   00071 Fatty acid degradation
    SGR_5794
   00561 Glycerolipid metabolism
    SGR_5794
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_5794
   00310 Lysine degradation
    SGR_5794
   00330 Arginine and proline metabolism
    SGR_5794
   00340 Histidine metabolism
    SGR_5794
   00380 Tryptophan metabolism
    SGR_5794
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGR_5794
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGR_5794
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGR_5794
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SGR_5794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAG22623
Kitasato: SGR5794
UniProt: B1W276
LinkDB All DBs
Position
6789678..6791072
Genome map
AA seq 464 aa AA seqDB search
MKAHDQMYIDGAWRPAAGQDTIAVVNPADEQVIAQVPAGTAEDVDAAVRAARAAFPAWAA
TPPAERAARLTALADALAARKDALAETITAELGSPLPLSQKVHAAVPVLVAASYAELTAR
YAFEERIGNSTVLLEPVGVVGAITPWNYPLHQIVAKVAPALAAGCTVVLKPAEDTPLTAQ
IFAEATEAAGLPPGVFNLVTGLGPVAGQALAAHEDVDLVSFTGSTAVGKRIGATAGAAIK
RVALELGGKSANVILPGADLARAVNVGIANVMTNSGQTCSAWTRMLVDAERYDEAVGLAA
NAVTKYVVGERVGPLVNAEQQARVRGYIARGVEEGARLIAGGPDAPLATGYYVSPTVFAD
VTPDMTIAQEEIFGPVLSILRYEDVDDALRIANDTVYGLAGAVWAADDEEAVAFARRMDT
GQVDINGGRFNPLAPFGGYKQSGVGRELGPHGLAEYLQTKSLQF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccatgaccagatgtacatcgacggtgcgtggcggcccgccgccggccaggac
acgatcgcggtcgtgaacccggccgacgagcaggtcatcgcccaggtgccggcgggaacg
gccgaggacgtcgacgcggcggtgcgcgccgcgcgcgcggccttccccgcctgggccgcg
accccgcccgccgagcgcgccgcccggctcaccgcgctggccgacgcgctggcggcccgc
aaggacgcgctcgccgagacgatcacggccgagctgggctcgccgctgccgctgtcgcag
aaggtccacgcggcggtgcccgtgctggtggccgcctcgtacgccgaactcaccgcccgg
tacgccttcgaggagcggatcggcaactccaccgtgctgctggagccggtcggcgtggtc
ggcgcgatcaccccctggaactacccgctccaccagatcgtcgccaaggtcgcccccgcc
ctggccgcgggctgcaccgtcgtcctcaagcccgccgaggacaccccgctcaccgcccag
atcttcgccgaggccaccgaggcggccggcctgccgcccggggtcttcaacctcgtcacc
ggcctggggccggtcgccgggcaggcgctcgccgcccacgaggacgtcgacctggtctcg
ttcaccggctccaccgccgtgggcaagcggatcggcgcgaccgccggtgccgcgatcaag
cgggtcgccctggagctgggcggcaagtccgccaacgtgatcctgcccggcgcggacctc
gccagggcggtcaacgtcggcatcgccaacgtgatgaccaactccggccagacgtgcagc
gcctggacccggatgctggtcgacgccgagcggtacgacgaggccgtcgggctcgcggcg
aacgccgtcaccaagtacgtggtcggcgagcgggtcggtccgctcgtcaacgccgagcag
caggcccgggtgcggggctacatcgcccggggcgtcgaggagggcgcccggctgatcgcg
ggcggccccgacgcgcccctggcgaccggctactacgtcagccccaccgtcttcgccgac
gtcaccccggacatgacgatcgcccaggaggagatcttcggcccggtgctctcgatcctg
cggtacgaggacgtggacgacgccctccggatcgccaacgacacggtgtacggcctcgcc
ggcgccgtgtgggccgccgacgacgaggaggcggtggccttcgcccgccggatggacacc
gggcaggtcgacatcaacggcggccggttcaacccgctggccccgttcggcggttacaag
cagtcgggggtgggacgcgagctgggcccgcacggtctggccgagtacctccagaccaag
tcgctccagttctga

DBGET integrated database retrieval system