KEGG   Streptomyces griseochromogenes: AVL59_27695Help
Entry
AVL59_27695       CDS       T04729                                 

Definition
(GenBank) peptide synthetase
Organism
sgs  Streptomyces griseochromogenes
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6449556..6451337)
Genome map
AA seq 593 aa AA seqDB search
MEPELPSTRHPFRQVKTRPMARSLVELLTTHASDHPERTAYRHLVTGDGDGETQELTYAR
LVTRSRAVAAWLQERGLAGSRAMLLYPPGLEFICAYLGCLSAGVVAVPGVPPQGRSQNHR
ALTRMKRLMADADAKVILGGREVIAALDGMAGHLPELDVIARVATEDIPDDAAAAWREPE
LTADSVAFLQYTSGSTSAPRGVVVTHGNLLDNQRVITERMRHTPEAIAAHDQELFVSWLP
VYHDMGLIGPVLNTVYLGATATLFSPLHFLQRPDRWLTAVSRYRPHTSGGPNFAYELCLK
HAGPGLLDTLDLGSWKVAFNGAEPVRAATLRRFADTFASAGFRREALYPCYGLAEATLMV
TGGTVDTAPTLLAAADGAPNAGQADAAAVGCGRPGAGVTVAIVHPERLEELPEGEAGEIW
VSGASVAKGYWRNTLATRETFRAQLPGREGRFLRTGDLGFLRDGELFVTGRLKDLIVIDG
RNHYPQDLELSAELVHPALRPGCTAAFPVDSAAEGEQPVLVAEIAPDRAGESEKITDLIR
SAVGEAHGLSLRDVVLVKPGTIPKTSSGKIQRRATRTAYLDGTLSSVTTVAVG
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggaacccgaactcccgtctactcgccacccattcagacaggtgaagactcgtcctatg
gctcgttccctggtcgaactgctgaccacgcacgcctccgaccacccggagcgcaccgcg
taccgccatctcgtcaccggtgacggtgacggagagacccaggaactcacctacgcccgg
ctggtcacccgctcccgggccgtcgccgcctggcttcaggagcgcgggctggccggttcg
cgcgccatgctgctctacccgcccggcctggagttcatctgcgcctacctcggctgcctc
tcggccggtgtggtcgccgtaccgggtgtgcccccgcaggggcgctcccagaaccaccgt
gcgctgacccggatgaagcgcctgatggccgatgccgacgccaaggtcatcctgggcggc
cgcgaggtgatcgccgccctcgacggcatggccgggcacctgcccgaactcgacgtgatc
gcccgcgtcgccaccgaggacatacccgacgacgcggcggccgcctggcgcgagcccgaa
ctcaccgcggactccgtcgcgttcctccagtacacgtccggctccacctcggccccgcgc
ggtgtcgtggtcacccacggcaacctgctggacaaccagcgggtcatcaccgagcgcatg
cgccacacacccgaggcgatcgccgcacacgaccaggagctgttcgtcagctggctgccg
gtctaccacgacatggggctcatcggcccggtcctgaacaccgtgtacctcggcgccacc
gccaccctgttctcgcccctgcacttcctgcagcggccggaccgctggctcacggcggtc
agccgctaccgcccgcacaccagcggcggccccaacttcgcctacgagctgtgcctgaag
cacgccggcccgggcctgctcgacaccctcgacctcggctcctggaaggtcgccttcaac
ggcgccgaacccgtgcgcgcggccaccctgcgacgcttcgccgacaccttcgcctccgcc
ggattccgccgcgaggccctctacccctgctacggcctggccgaggccaccctgatggtc
accggcggtacggtggacaccgcgccgacgctgctcgccgccgcggacggcgccccgaac
gcgggccaggccgacgcggccgccgtgggctgcggtcggcccggtgccggagtgaccgtg
gcgatcgtccaccccgagcggctggaggagctgcccgagggagaggccggcgagatctgg
gtgagcggggcgagcgtcgccaaggggtactggcgcaacaccctcgccacccgcgagacg
ttccgcgcacagcttcccggccgcgagggccgcttcctgcgcaccggcgacctgggattc
ctgcgggacggcgagctgttcgtcaccggccggctcaaggacctcatcgtcatcgacggc
cgcaaccactacccgcaggacctggagctgagcgccgaactggtccacccggccctgcgc
cccggctgcaccgcggccttccccgtggactccgcggcggagggcgaacagcccgtcctc
gtcgccgagatcgcgcccgacagggccggcgagtccgagaagatcaccgacctgatccgc
agcgcggtcggcgaggcccacggtctgtccttgcgcgatgtcgtcctggtcaagcccggc
accatccccaagacctccagcgggaagatccagcgccgcgccacccggacggcgtacctc
gacggcaccctctcctcggtgaccaccgtcgccgtggggtga

DBGET integrated database retrieval system