KEGG   Streptomyces griseochromogenes: AVL59_28770Help
Entry
AVL59_28770       CDS       T04729                                 

Definition
(GenBank) heme peroxidase
Organism
sgs  Streptomyces griseochromogenes
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6702394..6704247
Genome map
AA seq 617 aa AA seqDB search
MSTHRTAPRHPPAGYRTSLPWRIITSAAQYVDRRIGWDRLPVPAGLLTLFGLRVRLRQKN
LYDTGQLPAIDQPEPAPPSASHQVNRSADGSHNDLGDPRMGMAGTRFGRNIPLEAIAPAA
PSDVLATPSPREVSRTLLTRDGLIAAESVNSLVAAWLQFMIRDWFSHGTSPTDRPWEVSL
VDDDPWPEHPMKIMRTPDDPTRDPQAPRGTPDTRVNVSSHWWDASQIYGKNAAEQHQLRT
GERGRLHLWDDEQAPVPADPSQDPIYVPGFWLGLAMMQDLFTREHNAICEHLHGAYPSWS
DEELFQRARLINSALLAKIHTVEWTPAVISHPTTVKALRANWWGIAGERVHDLFGRISDS
EVISGIPGGETDHYGVPYALTEEFVAVYRMHPLVRDEWHLRAVADDTTLRHCTLRDIAGP
GALKFLETTEMADLLYSFGTLHPGLVTLHNFPKFLQEFERPDGHLQDLAATDILRSRELG
VPRYNEFRRLLRLKPAESFSELAHDPATAKQFERLYDGDIEKVDLMVGLYAEKLPAGFAF
SDTAFRIFILMASRRLNSDRFFTTHYTPEVYSKAGMAWIDDNSMVTVLLRHHPELRTALS
GLTNAFVPWHSTAPPET
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcaccgaaccgccccacggcaccccccggccggataccgcacgtcactcccc
tggcggatcatcaccagtgccgcccagtacgtcgaccgccgcatcggctgggacagactg
cccgtgccggcaggcctgctgacgctcttcgggctccgtgtccggctccggcagaagaac
ctgtacgacaccggtcagctgcccgcgatcgaccagcccgagcccgcgcccccgtccgcg
agccaccaggtcaaccggagcgccgacggcagccacaacgacctcggcgacccacgcatg
ggcatggccggcacccgcttcggccggaacattccactggaggccatcgcgccggccgcg
ccctcggacgtactggccacgcccagtccgcgcgaggtcagccgtaccctgctcacccgc
gacgggctcatcgcggccgaatccgtgaactccctggtcgccgcctggctccagttcatg
atccgcgactggttcagccacggcacgagccccacggaccggccctgggaggtttccctg
gtggacgacgacccctggccggaacaccccatgaagatcatgcggaccccggacgacccc
acgcgtgacccccaggcgccccgcggaacgcccgacacccgcgtcaatgtgtcctcccac
tggtgggacgcgtcccagatctacgggaagaacgcggccgaacagcaccagttgcgcacc
ggagagcggggcaggctgcacctgtgggacgacgagcaggcacccgtcccggccgacccc
tcccaggaccccatatacgtccccggcttctggttgggcctcgccatgatgcaggacctg
ttcacccgggagcacaacgcgatctgcgagcatctgcacggcgcctacccgtcctggagc
gacgaggagctgttccagcgtgcccggctcatcaactccgctctcctcgcgaagatccac
accgtggagtggacaccggccgtgatcagtcaccccaccaccgtcaaggcgctgcgcgcc
aactggtggggcatcgcgggcgagcgcgtccacgacctgttcgggcgcatcagcgacagc
gaggtcatcagcggcatccccggcggcgagacggatcactacggcgtcccgtacgcgctc
accgaggagttcgtggcggtgtaccggatgcacccgctggtccgcgacgaatggcatctg
cgtgccgtcgccgacgacacgaccctgcgccactgcaccctgcgcgacatcgccgggccg
ggagcgctgaagttcctggagaccacggagatggccgacctgctctacagcttcggcacg
ctgcatcccggactggtcaccctgcacaacttccccaagtttctccaggagttcgagcgc
cccgacgggcatctgcaggacctcgccgccaccgacatcctgcgctcccgggaactgggg
gtgccccgctacaacgagttccgtcggctgctgcggctcaagcccgcggagagcttctcg
gagctggcgcacgatccggcgacagccaagcagttcgagcggctctacgacggcgacatc
gagaaggtcgacctgatggtcgggctgtacgcggagaagctgccggccggtttcgccttc
agcgacacggcgttccgcatcttcatcctcatggcctcgcgccggctgaacagcgaccgg
ttcttcaccacccactacacccccgaggtctactccaaggccggcatggcctggatcgac
gacaacagcatggtcaccgttctgctgcgccaccacccggagttgcgtacggccctgtcc
gggctgaccaacgccttcgtgccgtggcacagcaccgcaccgccggagacctga

DBGET integrated database retrieval system