KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1870Help
Entry
SGGB_1870         CDS       T02018                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
sgt00473  D-Alanine metabolism
sgt01100  Metabolic pathways
sgt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SGGB_1870 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SGGB_1870 (alr)
Enzymes [BR:sgt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SGGB_1870 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sgt01011]
 Precursor biosynthesis
  Racemase
   SGGB_1870 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Pox_EPC_I2-L1
Motif
Other DBs
NCBI-ProteinID: BAK28726
UniProt: F5WWR9
LinkDB All DBs
Position
complement(1920585..1921691)
Genome map
AA seq 368 aa AA seqDB search
MISSLHRPTKAVIDLDAICQNIDAVKANIPQDKKAFAVVKANAYGHGATSVAQAIHHLVD
GFCVSNIDEALELREAGIEETILILGVIMPDEVALARDYHVTLTVASQEWLDLANEQGIS
LAGLDVHLKVDSGMGRIGVRSLDEAENVIANLKKAGANVAGIFTHFATADEADDTKFNEQ
LEFFTNLVNNLSDKPAIVHASNSATSIWHSETIFNLVRLGIVMYGLNPSGTELDLPYPLK
PALSLESSLVHVKTIPAGATVGYGATYTAQKEEYIATVPIGYADGWTRDLQGFSVLVNGE
FCEIVGRVSMDQITIRLPEKLPIGTKVTLIGQEGSKVISATDLAQKRGTINYEVLCLLSD
RIPRVYSK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagtttacacagaccaacaaaggcagtcattgatttagatgccatttgtcaa
aatattgatgcggttaaagccaatataccacaagataaaaaagcttttgcagttgttaaa
gctaatgcttatggacacggtgccacaagcgtagcgcaagctattcatcatcttgtggat
ggattctgtgtgtcaaatattgatgaagctttggaattacgtgaagcaggtattgaggaa
acaatccttattttaggtgttattatgcctgatgaggtggctttggcgcgtgattaccat
gttactttgacagttgctagtcaagaatggcttgatttggcaaatgaacaaggtattagc
ttagctggtttggacgttcacttgaaagtggattctggtatggggcgaatcggtgtgcgc
agtcttgatgaagcagaaaatgtgattgcgaatttgaaaaaagctggggctaacgttgca
ggtatctttacgcattttgcaacagcagacgaagctgacgatacgaaattcaatgaacag
ttggaattctttacgaatttggttaacaatttgagcgacaagcctgccattgtccatgct
agtaattcagcaacaagtatttggcatagtgaaaccatttttaaccttgttcgacttggg
attgtcatgtatggattgaatccaagtggaacagagcttgatttaccttatccgcttaaa
ccagcgcttagtttggaatcatcattggttcatgttaagacgattcctgctggtgcaacg
gttggctacggtgcgacctatactgctcaaaaagaggaatatatcgcgactgttccaatc
ggttacgcagacggttggacacgtgatttacaaggtttctcagtgcttgtgaatggcgaa
ttttgtgaaatcgttggacgcgtgtcaatggatcaaattaccattcgcttgccagaaaaa
cttccaatcggaacgaaagttactttgattggtcaagagggcagtaaggttatttcagcg
acagatttggctcaaaaacgtggcacaatcaattacgaagttctttgtctattgagtgac
cgtattccacgtgtttattcaaaataa

DBGET integrated database retrieval system