KEGG   Streptomyces glaucescens: SGLAU_04580Help
Entry
SGLAU_04580       CDS       T03327                                 

Definition
(GenBank) putative adenylation protein
Organism
sgu  Streptomyces glaucescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2 AMP-binding_C MG1
Motif
Other DBs
NCBI-ProteinID: AIR96942
UniProt: A0A089WZS0
LinkDB All DBs
Position
complement(1061624..1063306)
Genome map
AA seq 560 aa AA seqDB search
MTALRPRFPSILHALLAEAERGSDGSAVTLIPEPGREETLRYDALVENAARCAAALAERG
VGRGDRVVLCLPTGSRFITAFFGTQLAGAMPTAIAVPLRFGGAAGFEGQLKDLVGYLRPA
AVVTTSAVIQALDGLFDTPLIDGEELYARATASDAPQHPIRRPDGDDLALIQCTSGSTGK
PKGVMISHAHLAANCEQIVDVLGWTRADTTVSWAPLYHDMGLITGLLCPVHVGGDAVLMS
PSRFLRAPVEWLQYISHYRGAFGAAPNFAYGYLTSRVRDEDMEGVDLSSWRGALCGAEPI
QPVTVQRFVERFRRWGLPESAFVPGYGMAEATLAITSTRPDAPFRYDSIDRQSAVGGGRA
VDVDPDSTEALHIVDCGKPVAGTEVRIVDDEGRPLGENGIGHVQFRGPSRTSGYFDLPEE
TAACVDAPDWWRTGDIGYLRDGALRITSRAKDLVIIRGANYFPQDFEQAAETVPGVRLGA
VIAVGHRAEDADSEELHLIVETELDAEHHDALRQAVRSAVSSRTGVAPAEIHLVPKRSIP
KTTSGKLQRAKARELFVARP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactgcgtccgcgattcccgagtatcttgcacgcgttgctggccgaggcggag
cgcggttccgacggatccgcggtcacgctgatcccggaacccggccgcgaggagaccctg
cgctacgacgccctcgtcgagaacgccgcccggtgcgcggcggccctcgccgagcggggc
gtcggccgcggcgaccgggtggtgctctgcctgccgaccggctcgcggttcatcaccgcc
ttcttcggcacccagctggccggcgccatgcccacggccatcgccgtaccgctgcgcttc
ggcggcgccgccggcttcgagggccagctcaaggacctcgtcggctatctgcgccccgcc
gccgtcgtcaccacgtccgcggtgatccaggccctcgacggcctcttcgacaccccgctg
atcgacggcgaggagctctatgcccgcgccaccgcgagcgacgccccccagcacccgatc
cgccgtccggacggcgacgacctggccctgatccagtgcacctccggctccacgggcaag
cccaagggcgtgatgatctcgcacgcccacctggccgcgaactgcgagcagatcgtcgac
gtcctcggctggacccgtgcggacacgaccgtcagctgggccccgctctaccacgacatg
ggcctgatcacgggcctgctgtgcccggtccacgtcggcggcgacgcggtgctgatgtcc
ccctcgcggttcctgcgcgccccggtcgagtggctccagtacatcagccactaccgcggc
gccttcggagccgccccgaacttcgcctacggctacctcacctcccgcgtccgcgacgag
gacatggagggcgtggacctgtcgtcctggcgcggggcgctctgcggggcggaacccatc
cagcccgtcaccgtgcagcgcttcgtcgagcgcttccgccgctggggcctgcccgagagc
gccttcgtccccggctacggcatggccgaggcgaccctggccatcaccagcacccggccg
gacgcgccgttccggtacgactccatcgaccggcagtccgcggtcggcgggggacgggcc
gtcgacgtcgacccggacagcaccgaggccctgcacatcgtcgactgcggcaagccggtg
gccggcaccgaggtgcgcatcgtcgacgacgagggccggccgctcggggagaacgggatc
gggcacgtccagttccgcggcccctcgcgcacgtccgggtacttcgacctgcccgaggag
accgcggcgtgcgtcgacgcgcccgactggtggcgcaccggggacatcggctacctgcgg
gacggcgcgctgcggatcaccagccgcgccaaggacctcgtcatcatccgcggggccaac
tacttcccgcaggacttcgagcaggccgcggagaccgtgcccggtgtccggctgggcgcg
gtgatcgcggtcgggcaccgggccgaggacgccgactccgaggaactgcacctgatcgtc
gagacggagctggacgcggagcaccacgacgcgctgcgccaggccgtgcggtccgcggtc
agctcccggaccggcgtggcccccgccgagatccatctcgttcccaagcgcagcatcccc
aagacgaccagcgggaagctccagcgggccaaggcccgcgagctgttcgtcgcccggccg
tag

DBGET integrated database retrieval system