KEGG   Streptomyces glaucescens: SGLAU_10130Help
Entry
SGLAU_10130       CDS       T03327                                 

Gene name
amy
Definition
(GenBank) Alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sgu  Streptomyces glaucescens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGLAU_10130 (amy)
Enzymes [BR:sgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SGLAU_10130 (amy)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2306142..2307521)
Genome map
AA seq 459 aa AA seqDB search
MASSRTVSGAVALAAAAAFLAPAGAAHASPPGTKDVTAVLFEWNFASVAKECTTRLGPAG
YGYVQVSPPAEHIQGSQWWTSYQPVSYRIAGRLGDRTAFKNMVDTCHAAGVKVVVDTVIN
HMAAGNGTGTGGTAYTKYNYPGLYSSYDFDDCTAQISNYQDRWNVQRCELVGLADLDTGE
NYVRGAIAGYMNDLLSLGVDGFRIDAAKHMDAADLANIKSRLTNPSVYWKQEVIHGAGEA
VQPAEYTGNGDVQEFRYAYDLKRVFNNENLAYLKNYGEGWGYLKSSGAGVFVDNHDTERN
GSTLSYKDNATYTLANVFMLAWPYGAPDINSGYEFTDHDAGPPNGGRVDACWQSGWKCQH
AWPEIQRMVAFRNATRGEAVTNWWDNGGDAIAFGRGSKGFVAINHESGSLTRTYQTSLPA
GTYCNVQSNTPVTVNSSGQFTATLGAHTALAIHAGKPSC
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagcagaaccgtttccggcgccgtcgcgctcgccgcggcggcagccttcctg
gcacccgccggcgccgctcacgcctcccctcccggcaccaaggacgtcaccgccgtcctc
ttcgaatggaacttcgcctcggtggcgaaggagtgcaccacccgcctcggccccgccggc
tacggctacgtgcaggtctccccgcccgccgagcacatacaggggtcccagtggtggacc
tcctaccagccggtcagctaccggatcgccgggcggctgggcgaccgcaccgccttcaag
aacatggtcgacacctgtcacgcggccggagtgaaggtcgtcgtcgacaccgtcatcaac
cacatggccgcgggcaacggcaccggcaccggcggcaccgcgtacaccaagtacaactac
cccggcctgtactcgtcgtacgacttcgacgactgcaccgcccagatcagcaactaccag
gaccgctggaacgtccagcgctgcgaactggtcggcctcgcggacctggacaccggcgag
aactacgtgcgcggcgccatcgccggctacatgaacgacctgctctcgctcggcgtcgac
ggcttccgcatcgacgccgccaagcacatggacgccgccgacctggcgaacatcaagtcc
cgcctgaccaacccgtccgtctactggaagcaggaagtcatccacggcgccggcgaggcc
gtccagcccgccgagtacaccggcaacggcgacgtccaggagttccgctacgcctacgac
ctcaagcgggtcttcaacaacgagaacctcgcctacctgaagaactacggcgagggctgg
ggctacctgaagagctccggcgccggtgtcttcgtcgacaaccacgacaccgagcgcaac
ggctccacgctcagctacaaggacaacgccacctacaccctggccaacgtcttcatgctg
gcctggccctacggcgcgcccgacatcaactccggctacgagttcaccgaccacgacgcc
ggaccgccgaacggcggccgggtcgacgcctgctggcagagcggctggaagtgccagcac
gcctggcccgagatccagcgcatggtcgccttccgcaacgccacccgcggcgaggccgtc
accaactggtgggacaacggcggcgacgccatcgccttcggacgcggcagcaagggcttc
gtggccatcaaccacgagtccggctccctgacccgcacctaccagacctccctgcccgcg
ggcacgtactgcaacgtgcagagcaacaccccggtgacggtgaactccagtggccagttc
accgccaccctcggtgcccacaccgcactggcgatccacgccggcaagccgtcctgctaa

DBGET integrated database retrieval system