KEGG   Streptomyces glaucescens: SGLAU_11070Help
Entry
SGLAU_11070       CDS       T03327                                 

Gene name
mro
Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00010  Glycolysis / Gluconeogenesis
sgu00052  Galactose metabolism
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01130  Biosynthesis of antibiotics
Module
sgu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sgu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGLAU_11070 (mro)
   00052 Galactose metabolism
    SGLAU_11070 (mro)
Enzymes [BR:sgu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SGLAU_11070 (mro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: AIR98218
UniProt: A0A089X4X2
LinkDB All DBs
Position
2526188..2527333
Genome map
AA seq 381 aa AA seqDB search
MDMSRRTVIAGAAAAGVTAALSGTAHATGGIKPVKELFGRLADGTEVYRWSLENGGTRMK
VLSYGGIVQSLELPDRRGRYANVSLGFGTIEDYVSSSPYFGALIGRYGNRIDRGRFTLDG
TTYQLSVNDGDHSLHGGAQGFDKRVWDVQPFRRGSDVGLRLRHTSADGEMGYPGTLKAEV
TYTLTRSGDWRIDYEATTDKPTVCNLTSHVYFNLAGEGSGTVYDHELSIAASRYTPVDAG
LIPTGELAKVAGTPFDFRRTKTVGEDIRDAHQQLLYGKGIDHNWVLDKGITARPEHVATL
RDPRSGRTMKIATTEPGLQFYSGNFLDGTLVGSGGRIYRQGDALCLETQHFPDSPNQPSF
PSTVLRPGQTYRSTTVHSFGA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggacatgagcagacgtaccgtcatcgccggggcggccgccgccggtgtcaccgccgcg
ctcagcggcaccgcccacgccacgggaggcatcaagccggtgaaggaactcttcggcagg
ctcgccgacggcaccgaggtgtaccgctggtcgctggagaacggcggcacgcggatgaag
gtcctgtcctacggcgggatcgtccagtccctggagctgccggaccgccgcggcaggtac
gcgaacgtctccctgggcttcgggaccatcgaggactacgtgtcctccagcccgtacttc
ggcgcgctgatcggccgctacggcaaccgcatcgaccggggacgcttcaccctggacggc
acgacgtaccagctctccgtcaacgacggcgaccacagcctgcacggcggcgcgcagggc
ttcgacaagcgggtgtgggacgtgcagccgttccgtcggggctccgacgtcggactgcgc
ctgcgccacaccagcgccgacggcgagatgggctaccccggcaccctgaaggccgaggtg
acgtacacgctcacccggtccggcgactggcgcatcgactacgaggccaccaccgacaag
ccgacggtctgcaacctcaccagccacgtctacttcaacctcgcgggcgagggcagcggc
accgtctacgaccacgagctgtccatcgccgcctcccgctacaccccggtcgacgcgggc
ctgatccccaccggcgagctggcgaaggtggcgggcacccccttcgacttccgccgtacc
aaaaccgtcggcgaggacatccgggacgcccaccagcagctgctgtacggcaagggcatc
gaccacaactgggtcctggacaagggcatcacggcccgccccgagcacgtcgccacgctg
cgcgacccgcgctccggccgcaccatgaagatcgcgacgaccgagccgggcctgcagttc
tactccggcaacttcctcgacggcaccctcgtcggcagcggcggccggatctaccgccag
ggcgacgcgctctgcctggagacccagcacttcccggactcgcccaaccagccgtcgttc
ccgtcgacggtgctgcgcccggggcagacgtaccgctcgacgacggtgcactcgttcggc
gcgtga

DBGET integrated database retrieval system