KEGG   Streptomyces gilvosporeus: B1H19_10560Help
Entry
B1H19_10560       CDS       T05165                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv00010  Glycolysis / Gluconeogenesis
sgv00053  Ascorbate and aldarate metabolism
sgv00071  Fatty acid degradation
sgv00280  Valine, leucine and isoleucine degradation
sgv00310  Lysine degradation
sgv00330  Arginine and proline metabolism
sgv00340  Histidine metabolism
sgv00380  Tryptophan metabolism
sgv00410  beta-Alanine metabolism
sgv00561  Glycerolipid metabolism
sgv00620  Pyruvate metabolism
sgv00625  Chloroalkane and chloroalkene degradation
sgv00903  Limonene and pinene degradation
sgv01100  Metabolic pathways
sgv01110  Biosynthesis of secondary metabolites
sgv01120  Microbial metabolism in diverse environments
sgv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B1H19_10560
   00053 Ascorbate and aldarate metabolism
    B1H19_10560
   00620 Pyruvate metabolism
    B1H19_10560
  Lipid metabolism
   00071 Fatty acid degradation
    B1H19_10560
   00561 Glycerolipid metabolism
    B1H19_10560
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B1H19_10560
   00310 Lysine degradation
    B1H19_10560
   00330 Arginine and proline metabolism
    B1H19_10560
   00340 Histidine metabolism
    B1H19_10560
   00380 Tryptophan metabolism
    B1H19_10560
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B1H19_10560
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B1H19_10560
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B1H19_10560
Enzymes [BR:sgv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     B1H19_10560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ARF59344
UniProt: A0A1V0U2A1
LinkDB All DBs
Position
complement(2418224..2419642)
Genome map
AA seq 472 aa AA seqDB search
MTAHDGMYIDGAWRPAATAATIEVRNPADERVIATVPAGTAEDIDAAVRAARAALPAWRA
TAPAERAARLTALRDRLAARADEIAATITAELGCPAAFSTRVQTALPIAVTGSYAELAAS
YAFEEKLGNSTVLHEPVGVVGAITPWNYPLHQITNKVAPALAAGCTVVLKPAEDTPLTAR
LFAECVDAAGIPAGVFNLVTGLGTVAGQALAEHEGVDLVSFTGSTAVGRKIGAVAGGAVK
RVALELGGKSANVILPGADLAKAVGVNVADVIRNSGQSCNALTRMLVHADQYDEAVALAA
QGFAACAPGDPTAQETRLGPVVNARQRDRVRGFIAQGVKEGARLVTGGDDAPEGLGTGYY
VRPTVFADVTPDMTIAQEEIFGPVLSVLKYEDEDEAVRIANGTVYGLAGAVWAADEQTAV
AFARRLDTGQVDINGGRFNLLAPFGGYKQSGVGRELGPHGLTEYLQTKSLQF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacacgacgggatgtacatcgacggagcctggcggcccgccgccaccgccgcc
accatcgaggtgcgcaaccccgccgacgaacgggtgatcgcgaccgtaccggccggcacc
gccgaggacatcgacgccgccgtgcgcgccgcccgcgccgcactgcccgcctggcgcgcc
accgcccccgccgagcgcgccgcccggctgaccgcgctgcgcgaccgcctcgccgcccgc
gccgacgagatcgccgccaccatcaccgccgaactgggctgcccggcggccttcagcacc
cgggtccagaccgccctgccgatcgcggtgaccggttcgtacgccgaactggccgcctcg
tacgccttcgaggagaagctcggcaactccaccgtgctgcacgagccggtcggcgtggtc
ggcgcgatcaccccctggaactaccccctccaccagatcaccaacaaggtcgccccggcg
ctcgccgccggctgcaccgtcgtactcaagcccgccgaggacaccccgctcaccgcccgg
ctgttcgccgagtgcgtggacgcggcgggcatcccggccggcgtcttcaacctcgtcacc
gggctcggcaccgtcgccggccaggcgctcgccgagcacgagggcgtcgacctggtctcc
ttcaccggctccacggccgtcggccggaagatcggcgcggtcgcgggcggcgccgtcaag
cgggtggccctcgaactgggcggcaagtccgccaacgtcatcctgcccggcgccgacctg
gccaaggccgtcggcgtcaatgtcgccgacgtcatccgcaactccggccagtcctgcaac
gcgctgacccggatgctcgtccacgccgaccagtacgacgaggcggtcgccctcgccgcg
caggggttcgccgcctgcgcccccggcgaccccacggcgcaggagacccggctgggcccg
gtcgtcaacgccaggcagcgcgaccgcgtccgcggcttcatcgcccagggcgtcaaggag
ggcgcgcgcctggtgaccggcggcgacgacgcccccgagggcctcggcaccggctactac
gtccgcccgaccgtcttcgccgacgtcacccccgacatgaccatcgcccaggaggagatc
ttcggcccggtcctgtcggtcctgaagtacgaggacgaggacgaggccgtacggatcgcc
aacggcaccgtctacgggctcgccggcgccgtctgggccgccgacgagcagaccgcagtg
gccttcgcccgccgcctggacaccgggcaggtcgacatcaacggcggccgcttcaacctg
ctggcgcccttcggcggctacaagcagtccggcgtcggccgggaactgggcccgcacggc
ctgaccgagtacctccagaccaagtcgctccagttctga

DBGET integrated database retrieval system