KEGG   Streptomyces gilvosporeus: B1H19_18345Help
Entry
B1H19_18345       CDS       T05165                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv00473  D-Alanine metabolism
sgv01100  Metabolic pathways
sgv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sgv00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B1H19_18345
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B1H19_18345
Enzymes [BR:sgv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B1H19_18345
Peptidoglycan biosynthesis and degradation proteins [BR:sgv01011]
 Precursor biosynthesis
  Racemase
   B1H19_18345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ARF55883
UniProt: A0A1V0TSL4
LinkDB All DBs
Position
complement(4182830..4184143)
Genome map
AA seq 437 aa AA seqDB search
MNETAKRARAVIDLAAVRSNVRTLRGRAPGAELMAVVKSDGYGHGAVPCARAAREAGAAW
LGTALPEEAFALRAAGDTGRLLCWLWTPGGPWARAIEQDIDVTVSGLWALREVTEAARAC
GRTARVQLKTDSGLGRNGCQPADWPELTAAAAKAEADGAVRITGVWSHFACADEPGHPSI
ALQLAAFQDALAVAEAAGLRPEVRHLANTPALLTLPESHYDLVRAGIGIYGVSPNADLGT
PQDFGLRPAMTLEASLASVKRAPGGHGVSYGHHYTTPGDTTLALVPLGYADGIPRHASGT
GPVLVAGKRRTVAGRVAMDQFVVDLDGDVAEPGDTAVLFGPGDRGEPIAEDWARAAGTIG
YEIVTRIGSRVPRLYVDTDAPDGPGADAGGARRAGDVNMPVAQASVRHTPDMDAAGMDTC
AVDTDTEGDPKGTGGAV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacagcgaagcgggcccgcgccgtgatcgacctcgccgccgtgcggtcgaat
gtgcgtacgctgcgaggccgcgcacccggtgcagagctgatggccgtcgtcaagtccgac
ggctacggacacggcgcggtgccctgtgcccgcgccgcccgcgaagcgggagcggcctgg
ctgggcaccgccctgcccgaggaggcgttcgcgctgcgcgcggccggtgacaccggccgg
ctgctgtgctggctgtggacaccgggcggcccgtgggcccgtgccatcgagcaggacatc
gatgtgacggtcagcggtctgtgggcgctgcgcgaggtcaccgaggcggcccgcgcctgc
ggccgtacggcccgggtccagctcaagaccgacagcgggctgggccgcaacggctgccag
cccgccgactggcccgagctgaccgcggcggccgccaaggccgaggccgacggcgccgtc
aggatcaccggggtgtggtcccacttcgcctgcgccgatgagcccggccatccctcgatc
gcgctccagctggccgccttccaggacgcgctggccgtcgccgaggccgccgggctgcgc
cccgaggtacggcatctggccaacaccccggcgctgctgaccctccccgagtcgcactac
gacctggtgcgcgccggaatcggcatctacggcgtctcgcccaacgccgacctgggcaca
ccccaggacttcgggctgcgccccgcgatgaccctggaggcgtcgctggcgtcggtcaaa
cgcgccccgggcggccacggcgtctcctacgggcaccactacacgacccccggtgacacc
accctcgcgctggtcccgctcggctatgccgacggcatcccgcggcacgcctccggcacc
ggcccggtgctggtggcgggcaagcggcgcaccgtcgccggacgggtggcgatggaccag
ttcgtggtcgatctggacggggacgtcgccgagccgggcgatacggcggtgctgttcggg
ccgggcgaccgcggcgagccgatcgccgaggactgggcccgcgcggccggcaccatcggc
tacgagatcgtcaccaggatcggctcgcgggtgccgcggctgtatgtggacaccgacgcc
ccggacggcccgggtgcggacgccggtggcgcgcggcgcgccggtgacgtgaatatgccg
gtcgcgcaggcgtctgtgcggcatacgcctgacatggatgcggccggcatggatacatgt
gccgtggacaccgataccgaaggggatccgaagggtacggggggtgcggtatga

DBGET integrated database retrieval system