KEGG   Streptomyces gilvosporeus: B1H19_37045Help
Entry
B1H19_37045       CDS       T05165                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
sgv  Streptomyces gilvosporeus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ARF59045
UniProt: A0A1V0U1E1
LinkDB All DBs
Position
complement(8369579..8370652)
Genome map
AA seq 357 aa AA seqDB search
MDLPVMPPVSPMLAKLVTEIPAGMQYEAKWDGFRVIVFRDGAEVELTSRTTKPLTRYFPE
VVAAVREELPPRCVVDGEIVIAHDGRLHFEELLERIHPADSRVRTLAARTPASLVAFDLL
ALGGDSLLPESQAARREALVAALRTARPPVHTAPATTDQELARTWFTRFEGAGLDGVVAK
PLHLPYRPGERAMFKVKHARTADCVVAGYRLHKSGPVVGSLLLGLYDEAGQLQHVGVCAS
FPMARRRALVAELEPLRTDDVAAHPWGAWTDEEAHAARRMPGGPSRWSGGKDLSWLPLRP
ERVCEVAYDHMEGSRFRHTAQFRRWRPDRTPLSCTYAQLAEPVGYDLADLLGGPDAA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgcccccggtctcccccatgcttgccaagctcgtcaccgagatt
cccgccggtatgcagtacgaggccaaatgggacggctttcgcgtcatcgtgttccgcgac
ggcgccgaggtcgagctcaccagccggacgaccaaaccgctcacccgctatttccccgag
gtcgtcgccgccgtgcgcgaggagctgccgccgcgctgtgtcgtcgacggcgagatcgtc
atcgcccatgacggccggctgcacttcgaggagctgctggagcgcatccatccggccgac
tcccgggtccgtaccctcgccgcgcgcacgcccgcctccctcgtcgccttcgacctgctg
gcccttggcggcgactcgctgctgcccgagtcgcaggcggcgcggcgggaggcgctggtg
gccgcgctgcggacggcccggccgccggtgcacaccgcgcccgcgacgaccgaccaggag
ctcgcgcgcacctggttcacccggttcgagggagcgggcctggacggggtggtcgccaaa
cccctgcatctgccctaccggcccggcgagcgcgcgatgttcaaggtcaaacatgcccgt
acggccgactgcgtcgtcgcgggctaccgcctgcacaagagcggtccggtggtgggctcg
ctgctgctgggcctgtacgacgaggccgggcagttgcagcacgtcggggtgtgcgcctcg
ttccccatggccaggcggcgcgcgctcgtggcggagctggagccgctgcgcacggacgat
gtggccgcgcatccgtggggcgcgtggaccgacgaggaggcgcatgccgcccggcggatg
ccgggcgggcccagccgctggagcggcggcaaggacctgtcgtggctgccgctgcgcccg
gagcgggtatgcgaggtggcgtacgaccacatggagggcagccggttccggcacaccgcc
cagttccggcgctggcggcccgaccgtacgccgctcagctgcacctatgcgcagctggcg
gagccggtcggctatgacctcgcggacctgctcggcggtccggacgccgcctga

DBGET integrated database retrieval system