KEGG   Sulfurospirillum halorespirans: SHALO_0471Help
Entry
SHALO_0471        CDS       T04475                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
shal  Sulfurospirillum halorespirans
Brite
Translation factors [BR:shal03012]
 Eukaryotic Type
  Elongation factors
   SHALO_0471
 Prokaryotic Type
   SHALO_0471
Mitochondrial biogenesis [BR:shal03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SHALO_0471
Exosome [BR:shal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SHALO_0471
  Exosomal proteins of breast cancer cells
   SHALO_0471
  Exosomal proteins of colorectal cancer cells
   SHALO_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
476983..478182
Genome map
AA seq 399 aa AA seqDB search
MAKEKFSRTKPHVNIGTIGHVDHGKTTLTAAISAVLATKGLCEFKDYDGIDNAPEERERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFMNKADMVDDEELLELVEMEIRELLSVYDFPGDDTPIIAGSALKALE
EAKVGTVGAWGQKILDLMAAVDDYIPNPVRETDKDFLMPIEDVFSISGRGTVVTGKIDRG
AVKIGETIEIVGIKDTKTTTVTGVEMFRKEMERGEAGDNCGILLRGIKKEDVERGMVLCK
PKSITPHTDFEAEIYVLSKEEGGRHTPFFNNYRPQFYVRTTDVTGSITLPEGTEMVMPGD
NVKIKVAMIAPIALEEGTRFAIREGGRTVGAGVVSTIIK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagttctctagaaccaagccacacgttaacattggaaccatcggtcac
gttgatcatggtaaaactacgcttacagctgcgatctcagcagttctagcgacaaaaggt
ctttgtgaatttaaagattacgatggtattgataacgctcctgaagagagagagcgtggt
attactattgcaacttctcacattgaatatgaaacagaaaaccgtcactatgcacacgta
gattgtccaggacatgctgattatgttaaaaacatgattacaggtgctgctcaaatggat
ggcgcgattcttgttgtttctgcagcagatggtcctatgccacaaacgcgtgagcacatt
cttctttctcgccaagtaggcgttccatatatcgttgttttcatgaacaaagcggatatg
gttgatgatgaagaacttcttgagcttgttgaaatggaaatccgtgaacttctttctgtt
tatgacttcccaggtgatgacactccaatcattgcaggttctgcgcttaaagcacttgaa
gaagcaaaagttggtactgttggtgcatggggtcaaaaaattcttgatcttatggcagca
gttgatgattatattccaaacccagttcgtgaaacggataaagacttcttgatgccaatc
gaagacgtattctcaatctcaggtcgtggtaccgttgttactggtaaaatcgacagaggc
gctgttaaaatcggtgagactatcgaaatcgtaggtatcaaagatactaaaacaacaacg
gtaaccggtgttgaaatgttccgtaaagagatggagcgtggtgaggctggtgataactgc
ggtatcttacttcgtggtatcaaaaaagaagacgttgagcgtggtatggttctttgtaaa
ccaaaatcaatcactccacacactgactttgaagctgagatctatgttctttcaaaagaa
gagggtggccgtcatactccattctttaacaactatagaccacaattctatgttcgtaca
acagacgtaacaggttctatcacattaccagaaggtactgagatggttatgcctggtgat
aacgtaaaaatcaaagtagcaatgatcgctcctatcgctcttgaagagggtactcgtttt
gcaatccgtgagggtggtagaactgttggtgcgggtgttgtttcaacaatcatcaagtaa

DBGET integrated database retrieval system