KEGG   Sulfuritalea hydrogenivorans: SUTH_01723Help
Entry
SUTH_01723        CDS       T03591                                 

Definition
(GenBank) hypothetical protein
Organism
shd  Sulfuritalea hydrogenivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1739872..1742676
Genome map
AA seq 934 aa AA seqDB search
MEPASTAEPSAQLLSIVDRLVAEVRPGTRSQARLDSALDKDLGLDSLARVELLARIEQAF
GVRLPDDLLGSAETPRDLLRAVAAGTPAGGGDALDQAQWEAPAPVEEGKPEHATTLVEVL
QWHARRHPERPHVFFQRSASDTDTFSYGQLLATAREVAAGLRGIGVAPGQCVALMLPTGL
EFFQSFYGILLAGAVPVPIYPPTRPGQIEDHLRRQAGILQNCEAVALISFDAARLVARIL
SGLVPSLREVTTPEELRDAGRGAAPAADHRGHAGEIAFIQYTSGSTGNPKGVTLDHGNLL
ANIRAWGQAVALTPADVVVSWLPLYHDMGLIGAWLGSLYHACPLVLMSPLDFLARPERWL
WAIHQHRGTVTAAPNFAFELCLRHLDPARLQGLDLSSWRYAANGAEPVAAETLARFTAAF
HPYGFRAEALAPVYGLAECSVGLAVSPPGRGPLIDRVQREALAAGSALPAAPDDINALQL
VACGLPLPEHEVRIVDDGGAELPPRRVGRLEFRGPSATRGYYRNAEASAKLIRDGWLDSG
DLAYLADGDIFITGRIKDMIIRGGRNLYPYELEEAVGGIPGVRRGCVAVFGVPVAGQGTE
KLVVVAETRETRAAAREELVRRINGLTVDLLGTPPDDVVLAPLHAVLKTSSGKIRRAATR
EIYCGEGFAGGGRALWLQVVRLGLAGFRQGAVASIRRSGELLYGAYAWSIYGLLAPPAAA
GILLLPDPALRWRFAHAIARTCVRLCGVRLQVDGLEHWPPQAGVLVANHASYVDSIVLAA
TLPQPVAFVAKQELAAHPLAGPLLRRLGAAFVERFDARQGVDDVRRLADVAGTRSLFFFA
EGTFTRQKGLRPFRLGAFQIAVQNRLAVTPVVLAGTRDVLRDESWLPRCGAVRVSIGAPI
APAGEGWQAALQLRDATRAAILRDCGEPDLDGTP
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atggagccggcttcaacagccgaaccgtcggcgcaactgctgtccatcgtcgaccggctg
gtggccgaagtgcgcccggggacgcgctctcaggcgcggctcgacagcgcgctggacaag
gacctcgggctcgacagcctggcgcgggtggaactgctggcgcgcattgagcaggccttc
ggcgtgcgcctgcccgacgacctgctgggttcggccgaaacgccgcgcgatctgctgcgg
gctgtggctgccggcacgcccgctgggggcggagacgccctcgatcaggcgcaatgggaa
gcgccggcgccggtcgaggagggcaagcccgaacacgccacgactttggtcgaggtactg
caatggcatgcgcggcggcatcccgaacggccgcatgttttcttccagcgcagcgcaagc
gacaccgataccttcagctacggccaactgctggcgacggcgcgcgaggtggccgccggc
ctgcgcggcatcggcgtcgcgcccggccagtgcgtcgcgctgatgctgccgaccgggctg
gaattcttccagagcttctacggcatcctgctggccggcgcggtgccggtgccgatctat
ccgccgacgcggcccgggcagatcgaggaccacctgcgccgccaggccggcatattgcag
aactgcgaagccgtggcgctgatcagtttcgatgccgcgcggttggtggcgcgcatcctt
tccgggctggtgccaagcctgcgcgaggtgacgacccccgaggaattgcgcgacgcgggg
cgaggcgccgcgccggccgcggatcatcgcgggcatgccggcgagattgccttcatccaa
tacacctcgggctccaccggcaatcccaagggcgtgacgctcgatcacggcaacctgctg
gccaacatccgcgcctggggtcaggccgtcgcgctgacgccggccgacgtggtggtgagc
tggctgccgctgtatcacgacatgggcctgatcggcgcctggctgggcagcctctaccac
gcctgtccgctggtgctgatgtcgccgctggatttcctggcgcgccccgagcgctggctg
tgggccatccaccagcatcgcggcacggtcaccgccgcgcccaatttcgctttcgagctt
tgcctgcgccacctcgatccggcccggttgcaaggcctcgacctgagttcgtggcgctat
gcggccaacggcgccgagccggtggcggccgagacgctggcgcgcttcacggctgccttc
catccttacggctttcgcgccgaggcgctggcgccggtgtatggcctggccgagtgttcg
gtcggccttgccgtgtcgccgcccggacgcgggccgctgatcgaccgggtgcagcgcgag
gcgctggcagcaggttccgcgctgccggccgcgcccgacgacatcaatgccttgcaactg
gtggcctgcggcctgccgctgccggagcatgaggtgcgcatcgtcgatgatggcggcgcc
gaactgccgccgcgccgcgtcggccgcctggagtttcgcggaccgtcggcgacgcgcggc
tactaccgcaatgccgaggccagcgcgaagctgattcgcgacggttggctcgattccggc
gacctcgcctatctcgccgacggcgatattttcatcaccggccgcatcaaggacatgatc
attcgcggcgggcgcaacctctatccctacgagctggaagaagccgtcggcggcattccc
ggcgtgcgtcgcggctgcgtcgcggtgttcggcgtgccggtggccgggcagggcaccgag
aaactggtggtggtggcggaaacccgtgagacgcgcgcagcggcccgcgaggaactggtc
cgccgcatcaacggcctgaccgtcgatctgctcggcacgccgccggacgatgtggtgctg
gcgccgctgcatgccgtgctgaaaacctcgagcggcaagatccggcgcgcggcgacgcgc
gagatttattgcggcgaaggatttgccggcggcggccgtgcgctttggttgcaggtcgtg
cggctcggcctggccggtttccggcagggcgccgtcgcctccattcggcgcagcggcgaa
ctgctctacggcgcttatgcctggagcatctacggcctgctggcgccgccggccgccgcc
ggcatcctgctgctgcccgacccggcgctgcgctggcgtttcgcgcacgcgatcgcgcgt
acctgcgtgcgcctgtgcggtgtccgtttgcaggtcgacggcctggagcattggccgccg
caggccggcgtgctggtcgccaaccacgccagctatgtcgacagcatcgtgctggcggcg
acgctgccgcagccggtggccttcgtcgccaagcaggagctggccgcgcatccgcttgcc
ggcccgctgctgcggcgtctgggggcagcctttgtcgagcgcttcgatgcgcggcagggc
gtcgacgatgtgcgtcgcctggcggatgtcgccggcacgcgctcgctgttcttcttcgcc
gaaggcaccttcacccgccagaagggcttgcggcccttccgcctcggtgcgttccagatc
gcggtgcaaaacaggctggcggtgacgccggtggtgctggccggcacccgcgacgtcctg
cgtgatgaatcctggctgccgcgatgcggcgcggttcgcgtcagcatcggcgcgccgatt
gctcctgccggcgaaggctggcaggcggcgctgcaactgcgcgatgcgacgcgggcggcg
atcctgcgcgactgcggcgagcccgatctggacggcacgccatga

DBGET integrated database retrieval system