Shewanella sp. ANA-3: Shewana3_1243 Help Entry Shewana3_1243     CDS       T00428                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism shn  Shewanella sp. ANA-3 Pathway shn00190   Oxidative phosphorylation shn01100   Metabolic pathways shn02020   Two-component system Module shn_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:shn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Shewana3_1243  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Shewana3_1243 Enzymes [BR:shn01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Shewana3_1243 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ABK47478 UniProt:  A0KUK9 LinkDB All DBs Position 1458282..1458398 Genome browser AA seq 38 aa AA seqDB search MWYFTWILGVLLACSFGVINALWLENTENMDRSSDDAE NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacgtggatattaggggttttgttagcctgttcttttggtgtgatcaac gccctgtggcttgaaaacacggagaacatggaccgctcaagcgatgacgctgagtaa

DBGET integrated database retrieval system