KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_5712Help
Entry
SHJGH_5712        CDS       T02531                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00020  Citrate cycle (TCA cycle)
sho00270  Cysteine and methionine metabolism
sho00620  Pyruvate metabolism
sho00630  Glyoxylate and dicarboxylate metabolism
sho00680  Methane metabolism
sho01100  Metabolic pathways
sho01110  Biosynthesis of secondary metabolites
sho01120  Microbial metabolism in diverse environments
sho01130  Biosynthesis of antibiotics
sho01200  Carbon metabolism
Module
sho_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sho_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sho_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SHJGH_5712
   00620 Pyruvate metabolism
    SHJGH_5712
   00630 Glyoxylate and dicarboxylate metabolism
    SHJGH_5712
  Energy metabolism
   00680 Methane metabolism
    SHJGH_5712
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SHJGH_5712
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SHJGH_5712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AGF65375
LinkDB All DBs
Position
6482959..6483948
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVRLRLLEITPALKAAEGTAMELDD
CAFPLLQGIDITDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIRVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGSSVSDIK
RLTIWGNHSATQYPDIFHATVAGKNAAEVVNDEKWLAEDFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVHTWVNGTAEGDWTSMGIPSDGSYGVPEGLISSFPVTCKDGKYEIVQGLD
VNEFSRARIDASVKELEEEREAVRGLGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctcgggccagctgctcggcgcggacgtgccggtccgcctgcgc
ctccttgagatcaccccggccctgaaggccgccgagggcacggccatggagctggacgac
tgcgccttcccgctgctccagggcatcgacatcaccgacgacccgaacgtcgcgttcgac
ggcgccaacgtggccctgctggtgggcgcccgtccgcgcaccaagggcatggagcgcggt
gacctgctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gcggcggacgacatcagggtcctcgtcgtcggcaacccggccaacaccaacgcgctcatc
gcgcaggccgccgccccggacgtcccggccgagcgcttcaccgcgatgacccgcctggac
cacaaccgtgcgctgacccagctggcgaagaagacgggcagcagcgtctccgacatcaag
cggctcaccatctggggcaaccactccgccacccagtacccggacatcttccacgccacg
gtcgccggcaagaacgccgccgaggtggtgaacgacgagaagtggctggccgaggacttc
atcccgaccgtcgccaagcgcggtgcggcgatcatcgaggcccgtggcgcgtcctccgcc
gcctccgccgccaacgccgcgatcgaccacgtccacacctgggtcaacggcaccgccgag
ggtgactggacctccatgggcatcccgtcggacggctcctacggcgtcccggagggcctg
atctcctccttcccggtcacctgcaaggacggcaagtacgagatcgtccagggcctggac
gtcaacgagttctcccgggcccgcatcgacgcctccgtcaaggagctggaggaggagcgc
gaggcggtccgcggcctcggcctcatctga

DBGET integrated database retrieval system