KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_5712Help
Entry
SHJGH_5712        CDS       T02531                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SHJGH_5712
   00620 Pyruvate metabolism
    SHJGH_5712
   00630 Glyoxylate and dicarboxylate metabolism
    SHJGH_5712
  Energy metabolism
   00680 Methane metabolism
    SHJGH_5712
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SHJGH_5712
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SHJGH_5712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
6482959..6483948
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVRLRLLEITPALKAAEGTAMELDD
CAFPLLQGIDITDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIRVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGSSVSDIK
RLTIWGNHSATQYPDIFHATVAGKNAAEVVNDEKWLAEDFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVHTWVNGTAEGDWTSMGIPSDGSYGVPEGLISSFPVTCKDGKYEIVQGLD
VNEFSRARIDASVKELEEEREAVRGLGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctcgggccagctgctcggcgcggacgtgccggtccgcctgcgc
ctccttgagatcaccccggccctgaaggccgccgagggcacggccatggagctggacgac
tgcgccttcccgctgctccagggcatcgacatcaccgacgacccgaacgtcgcgttcgac
ggcgccaacgtggccctgctggtgggcgcccgtccgcgcaccaagggcatggagcgcggt
gacctgctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gcggcggacgacatcagggtcctcgtcgtcggcaacccggccaacaccaacgcgctcatc
gcgcaggccgccgccccggacgtcccggccgagcgcttcaccgcgatgacccgcctggac
cacaaccgtgcgctgacccagctggcgaagaagacgggcagcagcgtctccgacatcaag
cggctcaccatctggggcaaccactccgccacccagtacccggacatcttccacgccacg
gtcgccggcaagaacgccgccgaggtggtgaacgacgagaagtggctggccgaggacttc
atcccgaccgtcgccaagcgcggtgcggcgatcatcgaggcccgtggcgcgtcctccgcc
gcctccgccgccaacgccgcgatcgaccacgtccacacctgggtcaacggcaccgccgag
ggtgactggacctccatgggcatcccgtcggacggctcctacggcgtcccggagggcctg
atctcctccttcccggtcacctgcaaggacggcaagtacgagatcgtccagggcctggac
gtcaacgagttctcccgggcccgcatcgacgcctccgtcaaggagctggaggaggagcgc
gaggcggtccgcggcctcggcctcatctga

DBGET integrated database retrieval system