KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7012Help
Entry
SHJGH_7012        CDS       T02531                                 

Definition
(GenBank) trypsin-like protease
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(7971252..7972043)
Genome map
AA seq 263 aa AA seqDB search
MFGLTRARKTAATVVATAAAAASALLASPTASAAPQPIVGGTTTTTTAYPFMMQITDASQ
NQFCGGTLVAPKKVVTAAHCMVGETTSSVRVVGGRTYLNGTNGTVSRVSSIWINPDYTDA
TNGDDVAVLTLSTSMPYTAAKYVSSSQTSVYAAGTTARILGWGTTSENGGSSNQLRTATV
PVVSDSSCRSSYGSDFVQSDMVCAGYTSGGVDTCQGDSGGPLLIGGVLAGITSWGEGCAE
AGYPGVYTRLTTFSDLVTAQVGS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgttcgggctcacacgtgcaagaaagaccgccgcgaccgtggtggccaccgccgccgcg
gcggcgtccgcgctgctcgcctcccccacggcgagcgccgccccccagcccatcgtcggc
ggtacgaccaccacgacgaccgcgtacccgttcatgatgcagatcacggacgcgtcccag
aaccagttctgcggcggcaccctggtggcgcccaagaaggtggtgacggccgcgcactgc
atggtcggcgagaccacgagcagcgtccgcgtggtcggcggccggacctacctcaacggc
accaacggcacggtgagccgggtcagcagcatctggatcaacccggactacacggacgcc
accaacggcgacgacgtggccgtgctgaccctctcgacgtcgatgccgtacaccgcggcg
aagtacgtctcctcctcccagacgagcgtgtacgcggccggcaccaccgcccgcatcctc
ggctgggggaccacctcggagaacggcggctcctccaaccagctgcggaccgcgaccgtc
ccggtcgtgtccgactccagctgccgttcctcctacggttcggacttcgtccagtccgac
atggtctgcgccggatacacgtccggcggcgtggacacctgccagggcgacagcggcggt
cccctgctcatcgggggcgtcctggcagggatcacttcctggggcgaggggtgcgcggag
gccggttacccgggtgtctacacccggctgaccaccttctcggacctggtgaccgcgcag
gtcggctcgtga

DBGET integrated database retrieval system