KEGG   Shewanella putrefaciens 200: Sput200_3650Help
Entry
Sput200_3650      CDS       T02015                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
shp  Shewanella putrefaciens 200
Brite
Enzymes [BR:shp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sput200_3650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4157503..4158024
Genome map
AA seq 173 aa AA seqDB search
MNKLHLASLSILLLSGTAFAQESQVTMELLNAEGNTPIGTISLNDSEFGLVLTPNLSSLT
PGVHGFHVHQTGNCEPVTKDGKTVLGGGAGGHYDPDNTGKHGTPWSTDNHKGDLPPLYVD
EHGKATTAVLAPRLKVNDVKGKSLMVHVGGDNHSDHPAPLGGGGARMACGVIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattacacttagcctcgctctcaatcttgttactgagtggtaccgcgtttgca
caagagtcccaagtaaccatggagttgttgaatgcagagggtaatactccaattggcact
attagcctaaatgactccgaatttggtcttgttctcaccccaaacctgtcatctttaacg
ccaggtgtacatggttttcatgtacaccaaactggcaattgcgagccagtaactaaggat
ggaaaaacagtcttaggcggaggtgcgggtggacattatgatccagacaatacgggtaaa
catggaacgccatggtcaaccgataatcataagggcgatttaccgcctttatacgtcgat
gaacatggcaaggccacaactgctgtactagctcctcgcctgaaggtcaatgatgttaaa
ggtaaatctttgatggtccatgttggtggagataatcattctgatcatccagcacctctt
ggcggcggtggtgcacgtatggcttgtggtgttatcaagtaa

DBGET integrated database retrieval system