KEGG   Shigella sp. PAMC 28760: A0259_18615Help
Entry
A0259_18615       CDS       T04390                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
shq  Shigella sp. PAMC 28760
Brite
Enzymes [BR:shq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     A0259_18615
Lipid biosynthesis proteins [BR:shq01004]
 Acyl-CoA synthetase
  Unknown
   A0259_18615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3770960..3772648
Genome map
AA seq 562 aa AA seqDB search
MRYADFPTLVDALDYAALSSAGMNFYDRRCQLEDQLEYQTLKARAEAGAKRLLSLNLKKG
DRVALIAETSSEFVEAFFACQYAGLVAVPLAIPMGVGQRDSWSAKLQGLLASCQPAAIIT
GDEWLPLVNAATHDNPELHVLSHAWFKALSEADVALQRPVPNDIAYLQYTSGSTRFPRGV
IITHREVMANLRAISHDGIKLRPGDRCASWLPFYHDMGLVGFLLTPVATQLSVDYLRTQD
FAMRPLQWLKLISKNRGTVSVAPPFGYELCQRRVNEKDLAELDLSCWRVAGIGAEPISAE
QLHQFAECFRQVNFDNKTFMPCYGLAENALAVSFSDEASGVVVNEVDRDILEYQGKAVAP
GAETRAVSTFVNCGKALPEHGIEIRNEAGMPVAERVVGHICISGPSLMSGYFGDQVSQDE
IAATGWLDTGDLGYLLDGYLYVTGRIKDLIIIRGRNIWPQDIEYIAEQEPEIHSGDAIAF
VTAQEKIILQIQCRISDEERRGQLIHALAARIQSEFGVTAAIALLPPHSIPRTSSGKPAR
AEAKKRYQKAYAASLNVQESLA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatgccgattttccaacgcttgttgatgctttggactacgccgctctgagtagc
gccggaatgaatttttatgacagacgttgccaacttgaagatcaactggaatatcagacg
ttaaaagcacgtgccgaagctggtgcgaagcggttgttatcgctgaacctgaaaaaaggc
gatcgcgtggcactgattgccgaaacaagtagcgagttcgtagaggctttttttgcctgc
cagtatgccggcttagtcgccgtcccgttggcgattccaatgggcgttggtcagcgggat
tcctggagcgccaaattgcagggtttactggcaagttgccagcccgcagccattatcact
ggtgatgagtggttgccactggtcaatgccgcgacgcatgacaaccccgaattacatgtt
ttaagccacgcttggtttaaggcattatcggaagccgatgttgcgctccagcgtccagtt
ccgaacgatatcgcctacctccagtacacctccggcagcacccgttttccccgtggcgtc
attatcacccatcgcgaagtgatggctaatctacgtgctataagccacgacggcattaaa
ttacgccctggcgaccgctgcgcctcctggctgcctttctaccatgatatgggactggtc
ggctttctcctgacccccgtcgccacgcagctttcagtagattatttgcgcactcaggat
tttgccatgcgtcctctgcaatggcttaaattgatcagtaaaaatcgcggcaccgtttcc
gttgcgccgccgtttggctatgaattgtgccagcgccgcgtgaatgaaaaagatctcgct
gaactggatctttcctgctggcgcgtcgctggtattggtgcagaacccatctccgcagaa
caactccatcaattcgctgaatgtttccgtcaggttaactttgacaataaaactttcatg
ccgtgctacggactggcagaaaatgcgctggctgtcagcttctctgatgaagcctccggg
gttgtggttaacgaagtggatcgcgacatcctcgaatatcagggtaaagccgtcgcgccg
ggtgcagagacacgcgccgtatcgactttcgtcaactgcggcaaagcgttgccggaacat
ggtattgaaatccgcaatgaagcaggtatgccggtcgcggaacgtgtggtaggccatatt
tgcatctccggtcccagtctgatgagcggttactttggcgaccaggtttcgcaagacgag
attgccgcgacgggctggttagacaccggcgacctcggttatctgctggacggttatctg
tatgtcaccggacgcattaaagatctgattattattcgtggccgtaatatctggccgcag
gatattgaatatatagcggaacaggaaccggaaattcattctggcgatgcgattgctttt
gttaccgcccaggaaaaaatcattttgcagatccagtgtcggatcagcgacgaagaacgt
cgcgggcagcttatccacgcgctggcggcacggatccaaagcgaatttggcgtgaccgcg
gctatcgctctgttgccgccccacagtattccccgaacgtcctccggcaagcctgcccgt
gcggaagcgaaaaaacgttatcagaaggcttatgctgccagtcttaatgtgcaggaatcc
ctggcatga

DBGET integrated database retrieval system