KEGG   Sarcophilus harrisii (Tasmanian devil): 100918933Help
Entry
100918933         CDS       T02286                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100918933 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 813 aa AA seqDB search
MTDGSRSDVGRWGGSSWQPSVTPSPEPEPDTRSRGSGRSFWARCCSCCSCRGGADDDWGP
EPAGPRGSGSRGSGRPGSRGSRGSGRPGSRGSGVNAAGDGVVRDGMLVVTGVDLMSGRSD
QNRREHHTEDYEYDDLIIRRGQPFLVTVSLSRPYSSSDRMALELLIGANPEIGKGTHVII
PVGKGGSGGWKAQVIKSNGQHVDLKVHVSANAIVGKFRFTVRTRTDAGEFQLPFDPRNEI
YILFNPWCSDDPVYVEHESWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLY
ILDRRGMPYAGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILL
SYLRTGYSVPYGQCWVFAGVTTTVLRCLGIATRTVTNYNSAHDTDTSLTMDIYFDENMKP
LEHLNRDSVWNFHVWNDCWMRRSDLQSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNG
LVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLICTKAVGSNMREDITHI
YKHPEGSDAERKAVETAAAHGSKPNIYSNRDSAEDVSVQVEAQDAVMGQDLVVNVVLTNR
GSSRRTVKLHLYLSVTFYTGVTGPVFKDSKKEVALSPGSSERVALPVAYSEYRPHLVDQG
AMLLNVSGHVKENGQVIAKQHTFRLRTPDLSLTVLGAAVVGQETEVQIIFRNPLPVTLTK
VVFRLEGSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGRRQLIASLDSPQLSQVHGVIE
VDVAPASGGNFFSGNRGSSRSGENVPMALRGEA
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgggtcacgatcggatgtggggcgatggggtgggagctcctggcagcccagc
gtcacaccttctcctgagccagaaccagatactcgctcccgggggtcaggtcgctctttc
tgggcccgatgctgcagctgttgttcctgccgaggtggagctgatgatgactggggccca
gaacctgcaggcccccgaggttcaggttctcggggttcgggtcgccccggatcccgagga
tctcggggttccggtcgtcctggctccagaggcagtggggtcaatgcagcaggcgatggt
gttgtccgagatggcatgctggtagtgactggagtggatctgatgagcgggcgctctgat
cagaaccggcgggagcatcacacagaggactatgaatatgatgacctcatcattcgccga
ggacaacctttcctcgtcacggtcagcctgtctcggccctactcctcttcagaccgcatg
gccctggagctgcttatcggtgcaaaccctgaaataggcaaggggacccatgtgatcatt
cctgtgggcaagggagggagtgggggctggaaggcccaggtgatcaagtcgaacgggcag
cacgtggacctaaaagtccacgtctccgccaacgccatcgtgggcaagttccgctttacc
gtccgaacacgaactgacgcaggagagttccagttgccttttgatccccgaaatgaaatc
tacatcctcttcaacccttggtgttctgatgatcctgtgtatgtggaacatgaaagctgg
cgtcaagaatatgtactcaatgagtctggtcgaatttactatggcacagaggcacagatc
ggagagcgaacctggaactatggccaatttgaccacggtgtcctggatgcctgtctctac
atcttggaccggcggggaatgccatacgcagggcggggggaccctgtcagtgtctcccgt
gtcatctctgctatggtgaattctctagatgacaatggggttctgatcggaaactggtcg
ggagattactccagaggcacgaacccttcagcttgggtgggcagcgtggagatcctcctg
agctaccttcgaacaggctactcggttccctatggccagtgctgggtttttgctggtgtc
accaccacagtgctccggtgcctcgggatcgccaccaggaccgtcaccaactataactcg
gcccacgacacggatacttcactcaccatggacatttattttgatgagaacatgaagccg
ctggagcacctgaaccgtgattctgtgtggaacttccacgtctggaacgactgttggatg
aggcggtcagatctgcagtcgggttttgacggctggcaggtggtggatgccaccccccaa
gaaaccagtagtggcatcttctgttgtggtccctgctcagtggagtctattaagaatggc
ctggtctatatgaagtatgatacacccttcatctttgctgaggtcaacagtgacaaggtc
tactggcaacggcaggatgacggcagcttcaagattgtctatgtggaggagaaagcaatt
gggaccctcatctgcaccaaagctgttggctctaacatgagggaggatattactcatatc
tataaacaccctgaagggtctgatgcagagaggaaggcagtagagacggcagcagcccac
ggcagcaaacccaacatatactcaaaccgggattcagccgaagatgtgtcggttcaggtg
gaagcccaggatgcagtgatgggacaagacctagtagtcaacgtggtgctgaccaaccgt
ggaagcagtcggcgtactgtaaaattacacctctacctctccgtcaccttctacactggg
gtcactggccccgtcttcaaagacagcaagaaggaggtggcattgtcccctggaagctct
gagcgagtggctctgcctgtggcctactcagagtaccggccacatctggtggatcaggga
gctatgctgctgaacgtgtcaggtcacgtcaaagagaatgggcaggtgatcgccaagcaa
cacaccttccgccttcggacccctgacctctccctcacggtgctgggggcagctgtagtc
ggccaggagacagaagtacagattatcttcaggaacccactgcctgtcactctcaccaaa
gtggtcttccgactggagggctctgggctccagaggcccaaggttctcaatgttggagac
attggaggaaatgaaacagtgacactacgtcaaacatttgtgcctgtgcggccaggtcga
cggcagctcattgccagcttggacagccctcagctctcccaggtgcatggagtcatcgag
gtagacgtggccccggcttctggtgggaactttttctccggtaaccgaggtagcagtcgc
tctggagagaatgtccctatggcactccgaggagaagcctaa

DBGET integrated database retrieval system