KEGG   Sarcophilus harrisii (Tasmanian devil): 100922476Help
Entry
100922476         CDS       T02286                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04068  FoxO signaling pathway
shr04146  Peroxisome
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100922476 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100922476 (SOD2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    100922476 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100922476 (SOD2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100922476 (SOD2)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100922476 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100922476
NCBI-ProteinID: XP_003769623
Ensembl: ENSSHAG00000014795
UniProt: G3WPQ6
LinkDB All DBs
Position
4
AA seq 225 aa AA seqDB search
MATMLRRVVCRRTNRLVPTLGCLGSRQKHNLPDLPYDYGALEPHINAQIMQLHHSKHHAT
YVNNLNVTEEKYKEALAKGDVTAQVALQPALRFNGGGHINHTIFWTNLSPNGGGEPKGEL
MEAIKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLKIASCSNQDPLQGTTGLI
PLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSERYSACKK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccatgctccgcagggtggtgtgcaggagaaccaataggttagtaccaactttg
ggatgcttgggctccaggcaaaagcacaatctccctgacttgccttatgattatggtgca
ttggagcctcacattaatgcacagatcatgcagttgcatcacagcaaacatcatgccact
tatgtgaataacttgaatgttacagaagagaaatataaagaggctctggcaaagggtgat
gttactgctcaggtagctctccagcctgcactgcggttcaatggtggtggtcatatcaat
cacactattttctggacaaaccttagcccaaatggtggaggagaacccaaaggggaattg
atggaagccatcaaacgtgattttggttctttcgaaaaatttaaggagaagttgacagct
gtgtcagttggtgttcaaggttcaggatggggttggcttggcttcaataaggagcaagga
cggctgaagattgcttcttgttctaaccaagatcctttgcaaggaacaacaggtcttatt
cctctactgggaattgatgtgtgggaacatgcttattaccttcaatataaaaatgttaga
cctgattatctaaaagcaatctggaatgtaatcaattgggagaatgtatctgaaagatac
tcggcttgtaaaaagtag

DBGET integrated database retrieval system