KEGG   Sarcophilus harrisii (Tasmanian devil): 100932157Help
Entry
100932157         CDS       T02286                                 

Gene name
OGDH
Definition
(RefSeq) oxoglutarate dehydrogenase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100932157 (OGDH)
  Amino acid metabolism
   00310 Lysine degradation
    100932157 (OGDH)
   00380 Tryptophan metabolism
    100932157 (OGDH)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     100932157 (OGDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 1020 aa AA seqDB search
MFHLRTCAAKLRPLTASQTVKTLSQNRPAAARTFQQIRCYGAPVAAEPFLSGTSSNYVEE
MYYAWLENPKSVHKSWDIFFRNANAGAPPGTAYQSPPPLSGALSALTQAQSLVHAQPNVD
KLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGFYGLDESD
LDKVFHLPTTTFIGGKESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRRKFETP
GIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENG
VDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRV
TDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILIHGDAAFAGQGIVY
ETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPE
AVMYVCNVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYA
ETLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRS
MSCPSTGLTEEVLTHIGNVASSVPVENFTIHGGLRRILKTRGEMVKNRTVDWALAEYMAF
GSLLKDGIHIRLSGQDVERGTFSHRHHVLHDQNVDKKICIPMNHLWPNQAPYTVCNSSLS
EYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPH
GMEGMGPEHSSARPERFLQMCNDDPDVFPKLDDFDVRQLYDCNWIVVNCSTPANFFHVLR
RQILLPFRKPLIVFTPKSLLRHPEARSNFDDMLPGSSFQRVIPDNGPASQNPEKTKRLLF
CTGKVYYDLTRERQARNMEADVAITRIEQLSPFPFDLLQKEVLKYPNAELAWCQEEHKNQ
GYYDYVKPRLRTTIDRAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTAFNLDSFKGLF
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatttacggacttgtgctgctaaattgaggccattgacggcctcacagactgtt
aagacactttcacaaaacaggccagcagcagctaggacgtttcaacaaattaggtgctat
ggtgcacctgtggctgctgagccctttttgagtgggactagttcaaattatgtggaggaa
atgtactatgcttggttggaaaaccccaaaagtgtacataagtcatgggacatattcttt
cgaaatgccaatgctggagccccgcctggcactgcctaccaaagccccccacccctgagt
ggtgccttgtcagcactgacccaagcccaatccttggttcatgcccagccgaatgtagat
aagcttgtggaagaccatcttgcagttcagtctctcatcagggcatatcagattcgaggg
caccatgtagcacagctggatcccctgggaattttggatgctgatctggactcctccgtt
ccagctgatattatctcatccacagacaaacttgggttttatggattggacgaatcggac
ctcgacaaggttttccacttgcccactactactttcattggaggaaaggagtctgccctc
ccactccgagagatcattcgacggctagagatggcttattgccaacacattggagtggaa
ttcatgtttatcaatgacctggagcagtgccagtggatcagacggaaatttgagactcca
ggcatcatgcagtttacaaatgaggagaagcgtactctactagcaaggctggttcgctct
accaggtttgaagaattcttgcagcgaaaatggtcatctgagaaacgttttggcttagaa
ggttgtgaagtgttgataccggccctgaagactataattgacaagtcaagtgaaaatgga
gtggattatgtgatcatgggaatgccacacagagggcgcctgaatgtgcttgcaaatgtg
atcaggaaggaactggagcagattttctgtcaatttgattcaaaattggaggcggctgat
gagggttctggagatgtgaagtatcacttgggcatgtatcaccggaggattaaccgagta
acagacagaaacatcacgctgtccttggtggcaaatccttctcacctagaggctgctgat
ccagtggttatgggaaaaaccaaagctgaacaattttattgtggggatactgaaggcaag
aaggtgatgtccatccttatacatggagatgctgcatttgctgggcagggtattgtatat
gagacattccacttgagtgaccttccttcctatactacacatggcactgtgcacgtggta
gttaacaatcagattggctttaccacagaccctcgtatggcccgttcttctccataccct
actgatgtggcccgagtggtaaatgcaccaattttccatgtgaatgccgatgaccctgaa
gcagttatgtatgtgtgcaatgtggctgctgagtggagaagcacttttcataaggatgtg
gttgtggatttggtatgttacagacgtaatggtcacaacgaaatggatgagcctatgttc
actcagcccctcatgtacaaacaaatcagaaaacagaaacctgtgttgcagaaatatgct
gagaccctagtgtcacaaggagtggtaaatcagcctgaatatgaggaggagatttccaag
tatgataagatctgtgaggaggcctttgccagatctaaagatgagaagatcctacacatc
aagcattggcttgactcaccctggcctggtttttttactctagatggacagcccaggagt
atgtcttgtccttcaactggtctaactgaagaggttctgacacacataggaaatgtagcc
agctctgttcctgtagagaattttaccattcatgggggcttgagacgaattctaaaaacc
cgtggagaaatggtaaagaatcgaacagtggactgggcccttgctgaatacatggccttc
ggctcactcctgaaagatggaatccatattcggctcagtggccaggatgttgaacgggga
accttcagccatcgtcaccatgtgctacatgaccagaatgtagacaagaaaatctgcatt
cccatgaaccacctttggccaaaccaggctccatatacagtctgcaacagttctctgtct
gaatatggagtcttaggctttgagctaggctttgctatggcaagtcctaatgcccttgtc
ctttgggaggctcagtttggtgacttccacaacactgctcagtgcatcattgaccagttc
atttgcccaggacaggccaagtgggttcgacagaatggcattgtgttgctactcccccat
ggcatggaaggaatgggtccagagcattcatcagctagaccagagagatttctgcagatg
tgcaatgatgatccagatgtcttccctaaacttgatgactttgatgtgcgtcaactctat
gactgcaactggattgttgttaattgttccactcctgccaacttcttccatgtcctccga
cgacagatcttgctgcccttccggaagccgttgatcgtcttcactccaaagtcactgctg
cgtcaccctgaagccaggtccaactttgatgacatgcttccaggtagcagtttccagcgt
gttattccagacaatggtcctgcttcccagaacccagagaaaaccaagagacttcttttc
tgtaccggcaaggtgtactatgaccttactcgagagcgacaagccagaaacatggaggca
gatgtggctatcaccaggattgagcagctctccccgttccccttcgacctcctgcagaag
gaagtgctgaagtaccctaatgcagagctggcctggtgccaggaagagcataaaaatcag
ggttactatgactacgtgaagccaagacttcgcacgaccatagaccgagccaagcctgtc
tggtatgctgggcgtgaccctgctgctgccccagccacaggcaacaagaagacacacctg
acagagctgcagcgtctcctggatactgctttcaatctggactctttcaagggcttattc
tag

DBGET integrated database retrieval system