KEGG   Sarcophilus harrisii (Tasmanian devil): 100932392Help
Entry
100932392         CDS       T02286                                 

Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100932392
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     100932392
Glycosyltransferases [BR:shr01003]
 Glycan extension
  Glycolipid
   100932392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
6
AA seq 381 aa AA seqDB search
MSSCLLHPRCILLAALAFLCVWAIFGPSGLRKELSFTPPMPAPAAPAPPLSLPHLLIPNV
GACRSSGSQPFLLILVSTAPEHQEQRDAIRASWGALREIHGHLVRTLFILGEPDDSRWEN
IKEVLRWEAQVEGDIVQAAFTDSYRNLTLKTLSGLAWAARYCPNVHYVLKTDDDVYINVP
GLVAELDKREKDLQQRDPNRDRTVQGEAKAGERESEQPTRRPPAVPHLYLGHVHWRVYPS
RLKGSRHQVSEVQWPSERGAFPPYGSGTGYVLSAPVLRLILRAAGAVPLIPVEDIFVGVI
AKRVGVAPTHNSRIAGAARYPIDRCCFGRILLTSHHMEPWEMKSAWELVRGSSGNGDKPL
CSWLQETLGMLRCWMLNWWYF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctgccttctccatccacgctgcatcctcctggcggctttggcattcttatgt
gtctgggccatctttggtccctccgggctaaggaaggagttatccttcactcccccaatg
ccagccccagctgcaccggcacccccactctccttgccccaccttctgatccctaacgta
ggggcttgcagaagttctggttcccagccctttcttctgatcctagtgagcaccgcccct
gagcatcaagagcagagagatgctattcgagcctcctggggggctctccgggagatccat
ggtcacttggtccggactctcttcatacttggagaacctgatgatagtcgctgggaaaac
attaaggaggtgctaagatgggaagcacaggttgagggggatatcgtgcaggctgctttc
accgattcatatcgaaaccttaccctgaaaaccttaagtggactggcctgggcagccagg
tattgccccaatgttcattatgtcctcaagactgacgatgatgtttacatcaatgtccct
gggctcgtggctgaacttgacaaacgagaaaaggatctgcaacagagagatcctaacaga
gatagaactgttcaaggggaggccaaagctggagagagagaatcagagcagcccacgagg
cggccccctgctgtgccccatctgtaccttggccacgtccactggagagtttacccttcc
cgcttgaaggggagcaggcatcaggtgtcagaggtacagtggccttccgagcggggtgcc
ttccccccttacggctcaggcactggctatgtgttgtcagccccagtcctgcggctgatt
ctgagggcagctggtgctgtgcctctaatcccagtagaagatatttttgttggggtgatc
gccaagagggtcggggttgcacctacccacaactctcggatagcaggtgctgcccgatac
cccatcgaccgctgctgttttgggaggatcttgctaacttctcaccacatggagccctgg
gagatgaagagtgcctgggagcttgtgaggggttcctcagggaatggggacaagccactc
tgctcatggcttcaggaaactcttggaatgctgagatgttggatgctgaactggtggtat
ttttga

DBGET integrated database retrieval system