KEGG   Stereum hirsutum: STEHIDRAFT_124370Help
Entry
STEHIDRAFT_124370 CDS       T03127                                 

Definition
(RefSeq) glycoside hydrolase family 13 protein
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
shs  Stereum hirsutum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STEHIDRAFT_124370
Enzymes [BR:shs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     STEHIDRAFT_124370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MLSSLFVSALLAAPAFAASAEDWRNRTIYQLVTDRFALTNDSSGACDTSDRVYCGGSWQG
VINHLDYIQNMGFDAVWVSPVSTNFEGDSAYGQAFHGYWPSDLSSVNSHFGSDDDLKSLA
SALHDRSMYLMIDVVVNHLVYPSNPPTFSDFNPFNTESDFHSECFISDYNNQTDVEQCWL
GDSSLPLADTNTEDDTNVSSLNSWIKNLVSTYSADGIRIDTVKHIRQDFWPDFASSAGVY
TIGEVLHTDVAYIANYTQVLDGVLDYSTWYPLVSGFQSTSGNLSAITANYTALSSSFKNG
GFQSGSFLENHDQPRFQSMTTDQSLVKNAMTWPFINDGIPILYYGQEQGYSGGADPANRE
ALWSSGYEEDKDLVTHVKTLVAARKLAAAANSNFHSTASSFPTTTDESTMAVLKTPMLAL
LTNTGSSGSASFSTKGAGYSANEALVDVLTCTTVTADSSGEVGLAAKSGLPQVLLPVSAL
TSSGGVCTNLVSAAHVSARVPSAMVATTVLFALFRFLA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctctcttccctttttgtttctgctcttcttgcagcacccgcttttgcagcctcagcc
gaggattggaggaaccgcaccatctatcagcttgtcacggaccgcttcgccctcactaat
gattccagcggtgcatgcgacacttcagaccgtgtttactgtggaggctcatggcagggt
gtcatcaatcacctcgattacatccaaaacatgggcttcgacgccgtctgggtttctccc
gtcagcaccaacttcgaaggtgatagcgcttatggtcaggccttccacggttactggccc
tcagacctttcatcggtcaactcgcatttcggttccgacgatgaccttaagagccttgca
tcagcccttcatgaccgctcgatgtacctcatgattgatgtcgtcgtcaaccatctcgtc
tatccctccaaccctcctactttcagcgacttcaatcccttcaacaccgagtctgacttc
cactccgagtgcttcatctccgactacaacaaccaaactgacgtcgagcagtgctggctc
ggtgattccagcttgcctctggcagacaccaacactgaggatgacaccaatgtctcgagt
ttgaacagctggatcaagaacctcgtcagcacttacagtgccgatggtatccgtattgac
actgtcaagcacatccgtcaggacttctggcccgactttgcgagctccgctggagtctac
accatcggagaggttctacacaccgacgtcgcctatatcgccaactacacacaagtcctt
gacggtgttctcgattactctacctggtatcctctcgtatctggcttccagtcgacgtcc
ggaaatctctccgctatcacggccaactacaccgcactctccagctcgttcaagaacggc
gggttccaatcaggttcattcttggaaaatcatgatcagccccgtttccagagcatgacc
acggatcaatctctcgtcaagaacgcgatgacctggcctttcatcaacgatggtattccc
atcctgtactacggacaggagcaaggctactctggtggcgctgaccccgccaaccgtgag
gctctctggtcgtccggttacgaggaggacaaggatctcgttacccacgtgaagacgctc
gtcgctgcccgcaagctcgctgctgccgcgaacagcaacttccatagcaccgcttcctcg
ttccccacaactaccgacgaatccaccatggccgttcttaaaaccccgatgctcgctctc
cttactaacaccggctcctccggctcggcatccttctcgacaaagggcgctggctattcc
gctaacgaagcgctcgttgatgtcctcacttgcaccaccgtcactgccgactcttccggt
gaggtcggtctcgcagccaagtccggtctgccacaggtgttgttgcccgtcagtgcgctg
acgtcgagcggtggcgtgtgcacgaacttggtgagcgcggcacatgtcagcgcgagagtg
ccgagtgcgatggtggcgacgacggtgctgtttgcgctcttccgattcttggcgtga

DBGET integrated database retrieval system