KEGG   Stereum hirsutum: STEHIDRAFT_89876Help
Entry
STEHIDRAFT_89876  CDS       T03127                                 

Definition
(RefSeq) histone deacetylase complex catalytic component RPD3
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
shs  Stereum hirsutum
Brite
Enzymes [BR:shs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     STEHIDRAFT_89876
Chromosome [BR:shs03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     STEHIDRAFT_89876
   HDAC complexes
    Sin3A-HDAC complex
     STEHIDRAFT_89876
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    STEHIDRAFT_89876
  Chromatin remodeling factors
   NuRD complex
    STEHIDRAFT_89876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 547 aa AA seqDB search
MPGEVFPIEGESKKRVCYFFDSDVGGFHYGPGHPMKPTRIRMCHSLVMNYGLYKRMEIFR
AKPATKREMTQFHSDEYVDFLSKITPSNMNAFVKEQHKCNVGDDCPVFDGLFDYCSISAG
GSMEGAARLSRDKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRYHPRVLYIDI
DVHHGDGVEEAFYTTDRVMTASFHKYGEYFPGTGELRDVGIGKGKYYALNFPLRDGINDA
NYKSVFEPVIQEVMQSYQPSAIVLQCGTDSLAGDKLGCLNLSMRGHANCVKFVKSFNKPL
LLLGGGGYTMRNVSRAWAYETGLATGVELGPTIPTNEYYEYFGPDHQLDVKASNTEDMNS
PAYLERVRNIVMEHLRCLGGPPSVQMTDVPQHPIDAEMDDPNQDEDMIDPDDRRPPSMLD
RRVQASGELSDSDDEGEGGRRNHVSHRERSMSSNGSRTGRKFGMGVGIMTAPGAASTHGA
GPSGHTTMPPPGLGPMDQDVEQGSGNAGSESRAGSPVVQDSVQPGLDDELPISEQRDVVV
ERNGNGR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcgaagtattccccatcgaaggcgaaagcaaaaagcgagtttgctacttcttc
gattcggacgtgggagggtttcattatggtccggggcacccgatgaaaccgacccggatt
cggatgtgccactcattggtgatgaattacgggctatacaaaaggatggagatcttccga
gcgaaaccggccaccaagcgcgagatgacacaattccactcagatgaatatgtcgacttt
ctgagtaagatcacgccgagcaacatgaacgcatttgtcaaggaacagcacaaatgtaac
gttggagacgactgtcccgtatttgacggcttgttcgattactgttcaatatctgctggt
ggatccatggagggcgctgcacgactaagtcgggacaagtgcgacattgcagtcaactgg
gcgggaggcctgcaccacgcaaagaagagcgaagctagcggcttctgttatgtgaacgat
atcgtgttgggtatcctcgagttattacggtatcatcctcgggtactctatatcgacatc
gacgttcatcatggggatggcgtcgaggaggccttctataccactgatcgagtcatgact
gccagcttccacaagtacggagagtacttccccgggacgggtgagttgcgcgatgtcggg
atagggaagggtaaatattacgcgttgaattttccgctcagagacggaatcaacgacgcg
aattacaagagcgttttcgagcctgtaatacaagaagtcatgcagtcgtaccagccgtca
gccatcgtacttcaatgcggtaccgattcgttagctggtgataaactcggttgcctgaac
ctgtcaatgcgagggcatgcaaactgcgtcaaattcgtcaagtccttcaacaagccactg
cttttgctcggaggaggaggatataccatgcggaatgtcagtcgtgcatgggcatacgag
accggcctggcgacgggcgtggagcttggtcccaccatccccaccaacgagtattatgag
tatttcgggccggatcaccagctcgatgtcaaggcgtccaacacggaggatatgaactcc
ccggcgtatctcgagcgtgtgagaaatattgtcatggagcacttgcgatgtctcggtggt
cctcccagcgttcagatgactgatgtaccacaacacccaattgacgccgaaatggacgac
ccaaatcaagacgaggacatgattgaccctgatgaccgaagaccgcccagcatgctcgat
cgacgcgtccaagcgtccggagagctgtccgactctgacgatgaaggtgaaggtggtcga
cgaaaccatgtctcacaccgagaaaggtccatgagcagcaacggcagtcgcaccggaagg
aagtttggcatgggagtgggtatcatgactgctcccggagcagcatcgactcatggagca
ggacccagtgggcacacaaccatgccgcctcctggccttggacctatggaccaggatgtc
gaacagggttccgggaatgccggctccgagtcgcgtgcaggatccccggtggttcaggat
agtgttcagcctgggttggacgatgaattgccgatttcggagcagcgggatgtcgttgtt
gagcgaaatgggaacgggcggtga

DBGET integrated database retrieval system