KEGG   Staphylococcus hyicus: SHYC_03685Help
Entry
SHYC_03685        CDS       T03578                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
shu  Staphylococcus hyicus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SHYC_03685 (tdk)
Enzymes [BR:shu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SHYC_03685 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
800247..800849
Genome map
AA seq 200 aa AA seqDB search
MYEAYHSGWIECITGSMFSGKSEELIRRLRRGVYAKQKVIVFKPTIDDRYHKEKIVSHNG
NAIEAINITEASEIWQHDLTGVDIIGIDEIQFFDRTVVDIAQTLAERGYRVITAGLDMDF
KGEPFHPVPEMLAVSEHITKLQAVCAVCGASSSRTQRLIDGKPAKVDDPIILVGANESYE
PRCRAHHVILPSESKEEENE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaagcgtatcattcaggatggattgaatgcatcacaggcagtatgttcagcggt
aaatctgaagaactcattcgccgcttacgacgtggtgtttatgcgaaacaaaaggtgata
gtttttaaaccaacgatagatgatcgttaccataaagaaaaaatcgtttcacataatggt
aatgcaatagaagcaataaacatcactgaagcgagtgagatatggcaacatgatttaaca
ggtgtggatatcattggaatagatgaaattcaatttttcgatcgcactgttgttgatatt
gcccaaacactggctgaaagagggtatcgtgtgattactgcaggtcttgacatggatttt
aaaggagaaccatttcatcctgttccagagatgttagcagtaagtgaacatattacaaaa
ttacaagcagtatgtgccgtttgcggcgcttcttctagtcgtacacaaagactcatagat
ggaaaaccagcgaaagttgatgatccaatcatattagtgggtgccaatgaaagttatgaa
ccacgttgtcgcgcacaccacgtcattctaccaagcgagtcaaaagaggaggaaaatgag
taa

DBGET integrated database retrieval system