KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7611Help
Entry
SHJG_7611         CDS       T02063                                 

Definition
(GenBank) hypothetical protein
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AEY92878
UniProt: H2JQM4
LinkDB All DBs
Position
8664424..8665431
Genome map
AA seq 335 aa AA seqDB search
MELEVAGRTVRLSSPDKVFFPERGFTKLDLARYYAAVGPGILRALRNRPTTLERYPDGVG
GEWFYQKRAPKGMPGWIPTAHITFPSGRSADEMCPTEEAAVVWAAQYGTLTFHPWPVRAT
DVDHPDELRIDLDPQPGTDYADAARAARELRAVLDEFGGLRGWPKTSGGRGLHVFVPIEP
RWTFTQVRRAAIAVGREMERRMPDRVTIKWWKEERGSRIFLDYNQTARDRTIASAYSVRP
RPHAPVSAPLRWEEVGVAEPRDFDLATMPARFTDLGDVHADMDDHAFSLDTLLELARQDE
HDHGLGDLPYPPEYPKMPGEPKRVQPSRARREPSP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtggaactggaggtggcgggccggaccgtacgactgtccagcccggacaaggtgttcttc
ccggagcggggcttcaccaagctggacctcgcccggtactacgccgccgtcggccccggc
atcctgcgcgccctgcgcaaccgccccaccaccctggagcgctacccggacggcgtcggc
ggcgagtggttctaccagaagcgggcgccgaagggcatgcccggctggatcccgaccgcc
cacatcaccttccccagcgggcgcagcgccgacgagatgtgccccaccgaggaggccgcc
gtggtgtgggccgcccagtacggcaccctcaccttccacccctggccggtccgcgccacc
gacgtcgaccatcccgacgaactccgcatcgacctcgacccgcagcccggcaccgactac
gccgacgcggcccgcgccgcccgggaactgcgggccgtcctggacgagttcggcgggctg
cgcggctggccgaagacctccggaggccggggcctgcacgtcttcgtccccatcgaaccg
cgctggaccttcacccaggtgcgccgcgcggcgatcgcggtcggccgggagatggagcgc
cggatgccggaccgggtgaccatcaagtggtggaaggaggagcgcgggagccgcatcttc
ctcgactacaaccagacggccagggaccgcaccatcgcctccgcctattcggtacgcccc
cgcccgcacgcccccgtctcggcgccgctgcgctgggaggaggtcggggtcgccgaaccc
cgcgacttcgacctcgccaccatgccggcccggttcaccgatctcggtgacgtgcacgcc
gacatggacgaccacgccttctccctggacacgctgctggaactggcccgccaggacgaa
cacgaccacggcctgggcgacctgccgtacccgccggagtacccgaagatgcccggcgaa
ccgaaacgggtgcagccgagccgcgcccgccgcgagccgtcgccctga

DBGET integrated database retrieval system