KEGG   Sphingobium hydrophobicum: CJD35_17960Help
Entry
CJD35_17960       CDS       T05146                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
shyd  Sphingobium hydrophobicum
Pathway
shyd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:shyd00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CJD35_17960 (ligD)
Enzymes [BR:shyd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CJD35_17960 (ligD)
DNA repair and recombination proteins [BR:shyd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CJD35_17960 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ASY46349
UniProt: A0A249MYZ3
LinkDB All DBs
Position
II:694847..697351
Genome map
AA seq 834 aa AA seqDB search
MARKDALSTYNAKRDFDRTREPKGKVAKTGGNSFVVQKHAATRLHWDFRLEMDGVLKSWA
VTRGPSIDPADKRLAVRTEDHPLDYGTFEGLIPKGEYGGGTVMLWDRGTWEPIAGKSAAD
IEDGHLHFILHGERMKGEWLLVRMKGRPKEKRENWLLRKIDDKEAGSGDALVERALTSIV
TGRSMAEIEADKAGEQSLAGAHGKGFAAKMAAAKDHTAKISDRRKTRATALPRFVKPQLA
TLVDAVPTGNDWLHEIKYDGYRALIAASGQKVTLFTRNGLDWTEKFAPLTGAIAALDLPP
CLIDGEVVALDGNGNPDFSTLQQTLKRGHGQEDATRPLHLFAFDLLSLDGQDLKGLPTIE
RKERLEALLHQAESPIHVSDHVLGAGETLFRSLCEAGQEGIISKRADAPYRSSRTRSWVK
VKCTRRQEFVLVGWTRSNARGRPFASLLLAQHEGQKLVYKGKVGTGFDSQAMDELDKAMA
RLATDTAPVDVPRAETRGVSWIKPKLVAEIAFAEFTADGRVRHGSFLGLRADKPAKTVKP
EKPAPAPVPKSAIDISSRDRVIFPETGQTKGELADYYSRIAPLMLPFSANRPISLVRCPQ
GRAKKCFFQKHDSGAFGQEVRQMPIREKNGGSEDYIYVDSADGLLACVQMGTIEFHGWAS
RTDDVEKPDRMIFDLDPDEGLDFDKVKRAAKDIRDHLADIGLVSFAMLSGGKGVHVVVPL
TPGHNWDTHKDFASRFAQALSAAEPDRFTATMSKAKRKGRIFIDWLRNQRGSTAILPYSA
RARPGAPVAIPIDWEELDRMKDAHPFSIDDPDTLLKRSKGLKGWGFAAQALPEI
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaaggatgccctttccacctacaatgccaagcgggatttcgaccgcacgcgc
gaacccaagggcaaggtggcgaaaacaggcggcaacagcttcgtcgtgcagaaacatgcc
gcgacccgcctgcattgggattttcggctggaaatggacggggtgctcaaaagctgggcc
gtaacgcgagggccaagcatcgacccggccgacaaaaggctggccgtgcggacggaggat
cacccgctggattatggcacgttcgaaggcttgatccccaagggcgaatatggcggcggc
acggtaatgttgtgggatcgcggcacctgggaaccgatcgcaggaaagagcgctgccgat
atagaggatgggcacctgcatttcattctgcatggggagcggatgaagggcgagtggctg
ttggtgcggatgaaagggcgtcccaaggagaagcgcgaaaactggctgttgcgcaagatt
gacgacaaggaggccgggtcgggcgatgcgctggtcgaacgtgcgcttaccagcatagtg
acgggccgatcgatggcggagattgaggccgacaaggctggcgaacagtcccttgccggg
gcgcatggcaaaggcttcgctgcgaagatggcggcagcgaaggatcataccgccaaaata
agcgacaggcggaaaacgcgcgccacggccctgccccgcttcgtgaagccacaactcgcc
acgttggtggatgccgtgccgaccgggaacgattggctgcacgagatcaaatatgatggc
tatcgcgcgctgatcgccgcaagcgggcagaaagtgacgctttttacgcgcaacggcctg
gactggaccgaaaaattcgcgccgctcacgggtgcgatcgccgcgctggacctgccgccg
tgcctgatagacggcgaagtggtggcgctggacggcaatggcaatcccgatttctcgaca
ttgcagcagacgctcaagcgcgggcatgggcaggaggatgcgacacggccgctgcacctg
ttcgccttcgatctgctttcgctcgatgggcaagacctcaaggggctgcccaccatcgag
cgcaaggagcggctggaagcgctgctgcatcaggcggaatcgcccatccatgtctccgat
catgttctgggggccggagaaaccttgttccgatcgctttgcgaggccgggcaggaaggc
atcatctccaagcgcgccgacgcgccatatcgcagttcccgaacccgcagctgggtgaag
gtcaaatgcacccggcgccaggagttcgtccttgtcggatggaccaggagcaatgccagg
ggacgtcctttcgcgtccctgctgctcgcccagcatgaggggcaaaagctggtctacaag
ggcaaggtcgggaccggcttcgatagtcaggcgatggacgaactggacaaggccatggcc
cgcttggcaaccgacacggccccggtcgacgtgccccgcgcggagacgcgcggcgtaagc
tggatcaagccgaagctggttgccgaaatcgccttcgccgaattcactgccgatggtcgc
gtccgtcatggcagcttcctgggtctgcgtgccgataagccagcaaagacggtgaaaccg
gaaaagcccgcgcctgcccctgtgccgaagagcgcgatcgacatcagcagccgtgatcgg
gtcatcttccccgaaaccggccagaccaagggggaactggcggattattattcccgcata
gcgccgctgatgctgcctttctccgccaaccggcccatcagcctggtccgctgtccacaa
gggcgagcgaagaaatgcttctttcagaagcatgacagcggcgccttcggacaggaagtc
cgacagatgcccattcgcgagaaaaacggcgggtcggaagattatatctatgtcgacagc
gcggacggcctgctggcctgcgtccagatggggacgattgaatttcacggctgggccagc
agaaccgacgatgtggagaagcccgaccgtatgatcttcgaccttgacccggacgaagga
ctggactttgacaaggtgaagcgagcggccaaggatatacgcgatcatctcgctgacatc
gggcttgtctccttcgcgatgctgtcgggtggcaagggcgtgcatgtcgtcgtaccgctg
acgcccggtcacaactgggacacgcacaaggatttcgcgtcgcgcttcgcccaggctctg
agcgccgcagagcctgaccgcttcactgcgacgatgagcaaggcgaagcgaaagggccgc
atcttcatagactggttgcgaaaccagcgtggcagcacggccatcctcccctattccgcc
cgcgcccgccccggcgcgcctgtcgccataccgatcgactgggaagaactggacaggatg
aaggacgcccatcccttctccatcgatgatcccgacaccctgctgaagaggagcaaaggc
ctcaaaggctggggatttgcagcgcaagccctgccggaaatttga

DBGET integrated database retrieval system