KEGG   Shinella sp. HZN7: shn_22570Help
Entry
shn_22570         CDS       T04278                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
shz  Shinella sp. HZN7
Pathway
shz00250  Alanine, aspartate and glutamate metabolism
shz00410  beta-Alanine metabolism
shz00640  Propanoate metabolism
shz00650  Butanoate metabolism
shz01100  Metabolic pathways
shz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    shn_22570
   00650 Butanoate metabolism
    shn_22570
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    shn_22570
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    shn_22570
Enzymes [BR:shz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     shn_22570
Amino acid related enzymes [BR:shz01007]
 Aminotransferase (transaminase)
  Class III
   shn_22570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANH07412
UniProt: A0A1A9G8N7
LinkDB All DBs
Position
pShin-01:32886..34163
Genome map
AA seq 425 aa AA seqDB search
MTAMPLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGNRYIDFAAGIAVVNTGHRHPR
VIEAVKNQLDRFTHTCHQVVPYENYVELAERLNAITPGNFAKKTIFVTTGAEAVENAVKI
ARAATGRQAVIAFTGSFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHAPFPVEMHGTTVE
QSLGVLKKLFAADVDPNRVAAIIVEPVQGEGGFYPVPVNFMKALREICDQHGILLIADEV
QTGFARTGKLFAMEHYGIAADIMTMAKGLGGGFPIAAVTGRAEIMDAPGPGGLGGTYAGS
PIGVAAAHAVLDVIKDEDLCNRAENLGARLKQRLASLQDKVPEIVDIRGPGFMNAVEFND
VSTKQPSAEFANKVRLKALEKGLILLTCGVHGNVIRFLAPITIQDEVFAEALDILESAMI
EARAA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaatgcccctcacagaccgcaagaacgccgccatctcgcgcggcgtcggcatg
accacgcagatctacgccgaccgtgcggagaatgcggagatctgggacaaggaaggcaac
cgctacatcgactttgctgccggcatcgccgtcgtcaacaccggtcaccgccatccgcgc
gtcatcgaggccgtcaagaaccagctcgatcgcttcacccacacctgccaccaggtcgtg
ccctacgagaactatgtcgagctcgccgagcgcctgaacgccatcacccccggcaacttc
gccaagaagacgatctttgtcacgaccggcgcggaagccgtcgagaatgccgtgaagatc
gcccgcgccgccaccggccgccaggccgtcatcgccttcaccggcagcttccacggccgc
accttcatgggcatggccctgaccggcaaggttgtgccgtacaaggtcggcttcggcgcc
atgccgggcgacgtcttccatgcgcccttcccggtcgagatgcacggcacgaccgtcgag
cagtcgctcggcgtgctgaagaagctctttgccgccgatgtcgacccgaaccgcgtcgcg
gcgatcatcgtcgagccggtgcagggcgaaggtggcttctatccggttcccgtcaatttc
atgaaggcgctgcgcgagatctgcgaccagcacggcatcctcctcatcgccgatgaggtg
cagaccggctttgcccggaccggcaagctgttcgccatggagcactacggcatcgcggcc
gacatcatgaccatggccaagggcctcggcggcggcttcccgatcgcggccgtcaccggc
cgcgcggagatcatggacgcgcccggcccgggcggcctcggcggcacctatgccggcagc
ccgatcggcgttgcggcggcccatgccgttctcgacgtcatcaaggacgaggacctctgc
aaccgtgccgaaaacctcggcgcccgcctcaagcagcgcctcgcctcgctgcaggacaag
gttcccgagatcgtcgacatacgcggcccgggcttcatgaacgccgtcgagttcaacgac
gtttcgacgaagcagccgagcgccgagttcgccaacaaggtgcgtctgaaggccctcgaa
aaaggcctgatcctgctcacctgcggcgtgcacggcaatgtcatccgcttcctcgcgccg
atcaccatccaggacgaggtgttcgccgaggcgctcgacattctcgaaagcgcaatgatc
gaagcccgcgccgcctga

DBGET integrated database retrieval system