KEGG   Streptococcus intermedius B196: SIR_0273Help
Entry
SIR_0273          CDS       T02830                                 

Definition
(GenBank) hypothetical protein
Organism
sib  Streptococcus intermedius B196
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_16 CBM_4_9 DUF5011
Motif
Other DBs
NCBI-ProteinID: AGU75662
UniProt: T1ZDX7
LinkDB All DBs
Position
266686..268377
Genome map
AA seq 563 aa AA seqDB search
MEKKRFSLVILLTVCCMLFASHKVFADTNLVKNWDFEQGEAGWTSRNKGEISSKVSYGNG
KYSGVVPATAITNNKASGYIGQVIDVKPNTTYTVSAYAKTDTEGAIGYFTARWFDNNTQG
ELVKNSSGVAVDQNVNTTRWKKYTFTFHSGSHRKVLLQLVKWSDDERTKKSNIYIDNVEM
KAQSNQQSYKEIWRDDFDGTELDKTNWGYELGSIRGFEQQHYVRSKENVFLRDGNLILRA
TNRAPEDQYANPRNKSRKVIYNSGSVRTHGKKEFLYGRLEVRAKLPKGQGVFPAFWTLGS
DFTLDGKIHSAQGHGWPSTGEIDIMELVGEQNPLSRGNRTVYQTLHYGQREKDNGKFAGN
GTAYSLSNGTFNDDYHTFAIDWYKDHIDWLVDNKVVRSVRYSDDETARKILNKPQFAQLN
LAMGGDWPGPVGQNLAGTEFAIDYVSYSRNAEQEKQAQEYYANAPKLNGVRNVTISKGQI
PDLLKGITATPGYQVDYSIDNEQSFQDKGGNTSVDLLVKGQAEKNKIAQLKPGVYNIHYS
AYSSNMTYESKVARKTVTLTITE
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaaaagattttcactggtaatactattaaccgtgtgctgtatgttgtttgca
tcccataaggtctttgcagacacaaatctcgtaaagaattgggattttgaacagggtgaa
gccggctggacttccagaaataaaggtgaaattagttctaaagtcagctatggtaacggg
aaatattcaggtgtagttcctgcaacggcaattacaaataataaagccagtggctacatt
gggcaagttattgatgtaaaaccaaatacaacgtacactgtttcagcttatgctaaaaca
gatacggaaggagctataggttattttacagcgagatggtttgacaataatacgcaagga
gaacttgtgaaaaactcttcaggagtagcagttgatcagaatgtcaacacgactcgctgg
aaaaaatatacctttacttttcattctgggagtcatcgcaaagtattactccaattggta
aaatggtcagatgatgaaagaacgaaaaagtctaacatatacattgataatgttgaaatg
aaagcccagtctaatcaacaaagctataaagaaatttggcgtgatgattttgatggcaca
gaactagataagacaaattggggttatgaattaggctcaattcgaggcttcgaacaacaa
cattacgttagaagcaaagagaatgtcttcttgcgagatggcaatcttatcttaagagca
accaatcgtgctcccgaagatcaatatgcaaatccgcgtaataaaagccgcaaggttatt
tacaattctggcagcgtgagaacgcatggaaagaaagaattcctctatggtcgtcttgag
gtacgcgcgaaacttccgaaaggtcaaggagtttttccggcattttggactctgggttca
gattttacattagatggcaagattcattcagctcaagggcatggttggccttcaactggt
gaaattgatatcatggaattagttggagaacaaaatccgctctccagaggaaatcgtaca
gtttaccaaacacttcattatggtcaaagagaaaaagataatgggaaatttgctggaaat
ggtacggcctacagtctttctaatgggacttttaatgatgattatcatacatttgcgatt
gactggtataaagatcacattgattggttagtagataataaagtggttcgttcagttcgt
tatagcgatgatgaaactgctagaaaaatcttgaacaaaccacaatttgcccaattaaac
ttagcaatgggtggtgattggccaggaccagttggtcaaaacttagcaggtactgaattt
gctatagactatgtttcatactctcgcaatgcggagcaagaaaaacaagcgcaagaatat
tatgcgaatgctcctaagttaaatggcgttcgcaatgtgactatttcaaaaggtcaaatt
cctgacttattaaagggaattactgcaacaccaggttatcaggtggattactcaattgac
aatgagcagtcattccaagataagggtggtaacacttcggttgatttattggtaaaaggg
caagctgaaaaaaataaaattgcgcaattgaaaccaggagtgtataatattcactatagc
gcttattcgtcaaatatgacttatgaatcaaaagttgctagaaaaacggtgactttgaca
attactgaatag

DBGET integrated database retrieval system